DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and htr1ab

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001139238.1 Gene:htr1ab / 797538 ZFINID:ZDB-GENE-090409-2 Length:403 Species:Danio rerio


Alignment Length:394 Identity:105/394 - (26%)
Similarity:171/394 - (43%) Gaps:89/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSDSPSSELNIPYTV---FEVLVAIV-------SIIGNVLVIIVFRRERKLRRRTNYYIVSLAMA 86
            |.|..:..:.:|..|   :::..:::       ||.||..|:.....||.|:...||.|.|||:.
Zfish    16 DLDHQTDNVTLPVKVPLSYQISTSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVT 80

  Fly    87 DLLVGALGIPFAILA------SMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPM 145
            ||:|..|.:|.|.|.      ::|..    .|...:||.::.||.||..|.|:::||||||..|:
Zfish    81 DLMVSVLVLPMAALYQVLDKWTLGQV----TCDIFISLDILCCTSSILHLCAIALDRYWAITDPI 141

  Fly   146 AYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATIITP 210
            .|.:....:.|..:|::.|..|..:...|:.     :..:|....:...|..|.::..|.....|
Zfish   142 DYMKKRTLKRAALLITVTWFVGFSISIPPML-----IMKSQPKTCMISHDPWYTIYSTFCAFYIP 201

  Fly   211 ALLMLAFYTHIYRVIIKQVRQIV-----------TMNPA------SDLSRRSSAAV--------- 249
            .:|||..|..|::....::|:.|           |::||      .:||:...:||         
Zfish   202 LILMLVLYGRIFKAARFRIRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAVEPKPAACVN 266

  Fly   250 --------------VQV-----------TTP-------GRGGHTGTMLRVLGAARKRDVKATQNL 282
                          ::|           .||       .:........|.|..||:|  |..:.|
Zfish   267 GAIKHAEDGESLEIIEVHSNSKNNLPLPNTPNSVPLFENKHEKNTEAKRKLALARER--KTVKTL 329

  Fly   283 SIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCII--LSHLNSAVNPVLYAYHLKDFRAAL 345
            .||:..|::||:|.:....:..|||.| |.| |.|..:|  |.:.||.:||::|||..|||::|.
Zfish   330 GIIMGTFILCWLPFFIKALVMPFCPTC-VMP-LWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAF 392

  Fly   346 KNLL 349
            |.::
Zfish   393 KKII 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 53/180 (29%)
7tm_1 58..334 CDD:278431 91/341 (27%)
htr1abNP_001139238.1 7tm_4 46..>208 CDD:304433 52/170 (31%)
7tm_1 52..381 CDD:278431 91/341 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.