DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and taar12h

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001076378.1 Gene:taar12h / 795068 ZFINID:ZDB-GENE-041014-54 Length:344 Species:Danio rerio


Alignment Length:356 Identity:88/356 - (24%)
Similarity:157/356 - (44%) Gaps:68/356 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLLPLHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIV 81
            ||||.....|.:      .|:.::.: |.|. ||:.:.::.||:||||.....::|:..|:..:.
Zfish    18 PLLPDSCPRTQR------LPALKVAM-YAVM-VLMILTTVFGNLLVIISISHFKQLQSPTHLIVQ 74

  Fly    82 SLAMADLLVGALGIPFAILASMGLPRNLHACLFTVSLLVVLCTI-----------SIFCLVAVSV 135
            |||..|.|:|:|.:|::::      |::..|.:   |..|:|.:           ||..|..:::
Zfish    75 SLAACDCLLGSLVMPYSMV------RSVEGCWY---LGTVVCKVHSSLDMTFSISSILHLSLIAI 130

  Fly   136 DRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNH-NQECLFVEVMDYNYL 199
            ||:|||..|:.|...|...|....|:..|:...:..|..:|   ..||: ..|.|.:::..:...
Zfish   131 DRFWAISDPLRYKMRVTNTTVAGFITFTWLFSFVYSFSVVF---TGVNNVGLEELILQISCFGGC 192

  Fly   200 VFLY----------FATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTT 254
            |..:          |..:| |..:|.:.|..|:.|:.:.         |..:|.:.|||..    
Zfish   193 VLFFNKEWGLICALFVFLI-PGTIMSSLYMSIFNVVKRH---------AKVMSEKVSAAAT---- 243

  Fly   255 PGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFC 319
              .|.|..|       :..|:.||.:.|:|::..|.:||:|.:|...:..|..  :..|......
Zfish   244 --AGSHFQT-------SSHRERKAAKTLAIVMGVFYLCWLPFFTATAVDPFLN--FSTPGDVFDA 297

  Fly   320 II-LSHLNSAVNPVLYAYHLKDFRAALKNLL 349
            :: ..:.||..||::|.:....|:.|.|.|:
Zfish   298 LVWFGYFNSTCNPLIYGFFYPRFQKAFKILI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 47/189 (25%)
7tm_1 58..334 CDD:278431 73/298 (24%)
taar12hNP_001076378.1 7tm_4 49..325 CDD:304433 76/312 (24%)
7tm_1 51..313 CDD:278431 73/298 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.