DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and OPN1MW2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001041646.1 Gene:OPN1MW2 / 728458 HGNCID:26952 Length:364 Species:Homo sapiens


Alignment Length:370 Identity:86/370 - (23%)
Similarity:147/370 - (39%) Gaps:100/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADL--------------LVG--AL 93
            :|:.:.|.|.|:..|.||:....:.:|||...|:.:|:||:|||              :.|  .|
Human    57 SVWMIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVL 121

  Fly    94 GIPFAILASMGLPRNLHACLFTVSLLVVLCTIS-IFCLVAVSVDRYWAILYPMAYSRNVR--TRT 155
            |.|..:|..           :|||    ||.|: ::.|..:|.:|:..:..|..   |||  .:.
Human   122 GHPMCVLEG-----------YTVS----LCGITGLWSLAIISWERWMVVCKPFG---NVRFDAKL 168

  Fly   156 AIFIISMCWVAGTIVGFLPLFGW-----HA-------DVNHNQECLFVEVMDYNYLVFLYFATII 208
            ||..|:..|:...:....|:|||     |.       ||........|:    :|::.|.....|
Human   169 AIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQ----SYMIVLMVTCCI 229

  Fly   209 TPALLMLAFYTHIY---RVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGA 270
            ||..:::..|..::   |.:.||.::       |:                             :
Human   230 TPLSIIVLCYLQVWLAIRAVAKQQKE-------SE-----------------------------S 258

  Fly   271 ARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYA 335
            .:|.:.:.|:.:.::||.|..||.|.....|..|..|....||.:.......:...:..|||:|.
Human   259 TQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYV 323

  Fly   336 YHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDS 380
            :..:.||    |.:|::.|..:|..:|    .|.||:..:.|:.|
Human   324 FMNRQFR----NCILQLFGKKVDDGSE----LSSASKTEVSSVSS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 51/198 (26%)
7tm_1 58..334 CDD:278431 69/309 (22%)
OPN1MW2NP_001041646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43
7tm_4 61..>178 CDD:304433 37/134 (28%)
7tm_1 71..322 CDD:278431 69/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.