DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and TRHR

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_003292.1 Gene:TRHR / 7201 HGNCID:12299 Length:398 Species:Homo sapiens


Alignment Length:351 Identity:89/351 - (25%)
Similarity:150/351 - (42%) Gaps:70/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PSSELNIPYTVFEVLVAIV----SIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIP 96
            |.:.:.:.|.|..:|:.::    .|:||::|::|..|.:.:|..||.|:||||:|||:|      
Human    16 PRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMV------ 74

  Fly    97 FAILASMGLPR-----------NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPM----- 145
               |.:.|||.           ....||....|..:....|...:.|.:::||.||.:|:     
Human    75 ---LVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFL 136

  Fly   146 -AYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEV---MDYNYLVFLYFAT 206
             .:||      |..||...|...::...|..|....:::..::.:.:..   :..||...:|...
Human   137 CTFSR------AKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCGYKISRNYYSPIYLMD 195

  Fly   207 I----ITPALLMLAFYTHIYRVIIKQVRQIVTMNP-ASDLSRRSSAAVVQVTTPGRGGHTGTMLR 266
            .    :.|.:|....|..|.|::.        :|| .||....|.      |......|..|.|.
Human   196 FGVFYVVPMILATVLYGFIARILF--------LNPIPSDPKENSK------TWKNDSTHQNTNLN 246

  Fly   267 V---------LGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIIL 322
            |         ..::||   :.|:.|:::|:.|.:.|:|..|:..:.:|....:......|||.|.
Human   247 VNTSNRCFNSTVSSRK---QVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRIC 308

  Fly   323 SHLNSAVNPVLYAYHLKDFRAALKNL 348
            .:||||:|||:|....:.||||.:.|
Human   309 IYLNSAINPVIYNLMSQKFRAAFRKL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 46/195 (24%)
7tm_1 58..334 CDD:278431 78/309 (25%)
TRHRNP_003292.1 7tmA_TRH-R 26..331 CDD:320126 85/336 (25%)
TM helix 1 27..53 CDD:320126 6/25 (24%)
TM helix 2 60..85 CDD:320126 15/33 (45%)
TM helix 3 98..128 CDD:320126 8/29 (28%)
TM helix 4 141..162 CDD:320126 6/26 (23%)
TM helix 5 188..217 CDD:320126 5/28 (18%)
TM helix 6 259..289 CDD:320126 9/32 (28%)
TM helix 7 299..324 CDD:320126 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.