DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Lpar3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_075359.1 Gene:Lpar3 / 65086 MGIID:1929469 Length:354 Species:Mus musculus


Alignment Length:322 Identity:74/322 - (22%)
Similarity:138/322 - (42%) Gaps:62/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VAIVSIIG----------NVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGL 105
            :.||..:|          |.|||......||......|.:.:||.||...| :...|.:..:..:
Mouse    30 LVIVLCVGTFFCLFIFFSNSLVIAAVITNRKFHFPFYYLLANLAAADFFAG-IAYVFLMFNTGPV 93

  Fly   106 PRNLHACLFTVS-------LLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMC 163
            .:.|     ||:       ||....|.|:..|:.::|:|:.:|:....:|...:.|..:.|: :.
Mouse    94 SKTL-----TVNRWFLRQGLLDTSLTASLANLLVIAVERHMSIMRMRVHSNLTKKRVTLLIL-LV 152

  Fly   164 WVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQ 228
            |.....:|.:|..||:...|.:.......:...:||:|...:.::. ..:|:|.|..|| :.:|:
Mouse   153 WAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLIFWTVSNLLA-FFIMVAVYVRIY-MYVKR 215

  Fly   229 VRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICW 293
            ...:::.:.:..:|||.:...:.          .|::.||||                  |::||
Mouse   216 KTNVLSPHTSGSISRRRAPMKLM----------KTVMTVLGA------------------FVVCW 252

  Fly   294 IPLYTINCIKAF-CPDCYV-HPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMM 353
            .|...:..:... |..|.| |.|  .:.::|:.|||.:||::|:|..:|    :.|.:.||:
Mouse   253 TPGLVVLLLDGLNCKQCNVQHVK--RWFLLLALLNSVMNPIIYSYKDED----MYNTMRKMI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/184 (23%)
7tm_1 58..334 CDD:278431 66/294 (22%)
Lpar3NP_075359.1 7tm_4 42..309 CDD:304433 71/310 (23%)
7tm_1 48..293 CDD:278431 65/283 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.