DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Npffr1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_006256547.1 Gene:Npffr1 / 64107 RGDID:621570 Length:468 Species:Rattus norvegicus


Alignment Length:339 Identity:79/339 - (23%)
Similarity:152/339 - (44%) Gaps:71/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILA 101
            ||.:...:....||:.::.::||.||..:..:.|.:|..||.:|::||::|||||...:|..::.
  Rat    75 SSPVAAMFIAAYVLIFLLCMVGNTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGIFCMPTTLVD 139

  Fly   102 SM--GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCW 164
            ::  |.|.:...|..:..:..:..:.|:|.|||::|:|:..|::|  :...:..|.|:|.|::.|
  Rat   140 NLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFRCIVHP--FREKLTLRKALFTIAVIW 202

  Fly   165 VAGTIV---------------GFL--------PLFG-WHADVNHNQECLFVEVMDYNYLVFLYFA 205
            ....::               .|:        ||:. |.|........::..|:         ||
  Rat   203 ALALLIMCPSAVTLTVTREEHHFMLDARNRSYPLYSCWEAWPEKGMRKVYTAVL---------FA 258

  Fly   206 TI-ITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLG 269
            .| :.|..|::..|..|.|.:.:      ...||.|    :..||.:      ||.|.       
  Rat   259 HIYLVPLALIVVMYVRIARKLCQ------APGPARD----TEEAVAE------GGRTS------- 300

  Fly   270 AARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAF--CPDCYVHPKLTLFCIILSH----LNSA 328
               :|..:....|.::.|||.:.|:||:.:..:..:  ..:..:| .|:::...|:|    .:|:
  Rat   301 ---RRRARVVHMLVMVALFFTLSWLPLWVLLLLIDYGELSELQLH-LLSVYAFPLAHWLAFFHSS 361

  Fly   329 VNPVLYAYHLKDFR 342
            .||::|.|..::||
  Rat   362 ANPIIYGYFNENFR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 46/194 (24%)
7tm_1 58..334 CDD:278431 71/308 (23%)
Npffr1XP_006256547.1 7tm_4 90..>209 CDD:304433 34/120 (28%)
7tm_1 96..367 CDD:278431 71/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.