DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Gpr173

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_071591.1 Gene:Gpr173 / 64021 RGDID:620748 Length:373 Species:Rattus norvegicus


Alignment Length:375 Identity:96/375 - (25%)
Similarity:154/375 - (41%) Gaps:75/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AATTSKDAKDSDSPSSELNIPYT------VFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIV 81
            |.||.    :.:..|..|::|..      |...|:..||:.||.::.::..:||.|.:...|:::
  Rat     2 ANTTG----EPEEVSGALSLPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLL 62

  Fly    82 SLAMADLLVGALGIPFAILASMGLPRNLHACLFTVSLL---------VVLCTISIFCLVAVSVDR 137
            .|.:||.:..|:..|| :|||:     .|...:|.|.|         |:.|..:.|.|..:||.|
  Rat    63 DLCLADGIRSAICFPF-VLASV-----RHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVTR 121

  Fly   138 YWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLF--GWHADVNHNQECLFVEVMDYNY-- 198
            |.||.:...|::.:...|...:|.|.|.....:.|.|:|  |.:..:....:|:|    ::.|  
  Rat   122 YMAIAHHRFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIF----EHRYFK 182

  Fly   199 ----------LVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRR--------- 244
                      |..|..||......|:|..|.|       :..:.|.|.||  :|:.         
  Rat   183 ANDTLGFMLMLAVLMAATHAVYGKLLLFEYRH-------RKMKPVQMVPA--ISQNWTFHGPGAT 238

  Fly   245 SSAAVVQVTTPGRGGHTGTML--RVLGAARKR------DVKATQNLS----IIVLFFMICWIPLY 297
            ..||...:...|||....|:|  |..|.|..|      :||..:.|.    .|.|.|::.|.| |
  Rat   239 GQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSP-Y 302

  Fly   298 TINCI-KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALK 346
            .:.|. :.|...|.|..:.....:.:|...:||||::.....||.:..|:
  Rat   303 IVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKCLR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/190 (26%)
7tm_1 58..334 CDD:278431 83/320 (26%)
Gpr173NP_071591.1 7tm_GPCRs 23..351 CDD:421689 89/347 (26%)
TM helix 1 24..50 CDD:410628 6/25 (24%)
TM helix 2 57..82 CDD:410628 8/25 (32%)
TM helix 3 96..126 CDD:410628 9/29 (31%)
TM helix 4 138..160 CDD:410628 6/21 (29%)
TM helix 5 181..210 CDD:410628 5/28 (18%)
TM helix 6 279..309 CDD:410628 9/30 (30%)
TM helix 7 319..344 CDD:410628 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.