DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Gpr85

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_071590.1 Gene:Gpr85 / 64020 RGDID:71011 Length:370 Species:Rattus norvegicus


Alignment Length:345 Identity:77/345 - (22%)
Similarity:141/345 - (40%) Gaps:43/345 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PYTVFEVLVAI-----VSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPF---AI 99
            |.|.|..|.::     ||::||:|:.|:..:::.|.|...|:::.|..:|:|..|:..||   ::
  Rat    17 PLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSV 81

  Fly   100 LASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCW 164
            ............|.....|.|:.|..:.|.|..:||.||.||.:...|::.:...|.:.:|.|.|
  Rat    82 KNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVW 146

  Fly   165 VAGTIVGFLPLF--GWHADVNHNQECLFVEVM-----DYNYLVFLYFATIITPAL-LMLAFYTHI 221
            .....:.|.|:.  |.::.:....:|.|....     ...:::.|....:.|..: |.|.|:.|.
  Rat   147 TLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHD 211

  Fly   222 YRVIIKQVRQIVTMN-------PASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAA----RKR- 274
            .|. :|.|:.:..::       |.:.    ..||...:...|||....|:|.:...|    |:| 
  Rat   212 RRK-MKPVQFVAAVSQNWTFHGPGAS----GQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRL 271

  Fly   275 ----DVKATQNLS----IIVLFFMICWIPLYTINCI-KAFCPDCYVHPKLTLFCIILSHLNSAVN 330
                :.|..:.:|    |:...|:..|.| |.:.|. :.|.....|........:.:|...:.:|
  Rat   272 LVLDEFKMEKRISRMFYIMTFLFLTLWGP-YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGIN 335

  Fly   331 PVLYAYHLKDFRAALKNLLL 350
            |.:..:..::.|......||
  Rat   336 PFVCIFSNRELRRCFSTTLL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/183 (23%)
7tm_1 58..334 CDD:278431 68/307 (22%)
Gpr85NP_071590.1 7tmA_SREB2_GPR85 21..350 CDD:320346 73/334 (22%)
TM helix 1 23..47 CDD:320346 7/23 (30%)
TM helix 2 56..78 CDD:320346 7/21 (33%)
TM helix 3 95..117 CDD:320346 5/21 (24%)
TM helix 4 140..156 CDD:320346 4/15 (27%)
TM helix 5 182..205 CDD:320346 3/22 (14%)
TM helix 6 284..306 CDD:320346 6/22 (27%)
TM helix 7 318..343 CDD:320346 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.