DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Ptgdr

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_071577.1 Gene:Ptgdr / 63889 RGDID:619707 Length:357 Species:Rattus norvegicus


Alignment Length:278 Identity:50/278 - (17%)
Similarity:103/278 - (37%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IIGNVLVIIVFRRERKLRRRTN--------YYIV--SLAMADLLVGALGIPFAILASMGLPRNL- 109
            ::||:|.:::..|......|..        :|::  .|.:..||...|..|. :||:....|:| 
  Rat    30 LLGNLLALVLLARSGLGSCRPGPLHPPPSVFYVLVCGLTVTHLLGKCLISPM-VLAAYAQNRSLK 93

  Fly   110 -----------HACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI------ 157
                       .|..|.:|...:..|:.   |:|::::.:.::.:|..|.|::..|..:      
  Rat    94 ELLPASGNQLCEAFAFLMSFFGLASTLQ---LLAMALECWLSLGHPFFYQRHITARRGVLVAPVA 155

  Fly   158 --FIISMCWVA----GTIVGFLPLFGWHADVNHNQECLFV---EVMDYNYLVFLYFATIITPALL 213
              |.::.|.:.    |..|.:.|.......:.|.:....|   .|:..:.:..|..||::    .
  Rat   156 GAFSLAFCALPFAGFGKFVQYCPGTWCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVV----C 216

  Fly   214 MLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKA 278
            .|...:::|.:..:|...          .||.|....|..:..|.|....:         .::..
  Rat   217 NLGAMSNLYAMHRRQRHH----------PRRCSRDRAQSGSDYRHGSPNPL---------EELDH 262

  Fly   279 TQNLSIIVLFFMICWIPL 296
            ...|::..:.|.:|.:||
  Rat   263 FVLLALTTVLFTMCSLPL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 37/200 (19%)
7tm_1 58..334 CDD:278431 50/276 (18%)
PtgdrNP_071577.1 7tm_1 58..318 CDD:278431 45/250 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.