DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and gpr173

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_571573.1 Gene:gpr173 / 57926 ZFINID:ZDB-GENE-000710-1 Length:387 Species:Danio rerio


Alignment Length:377 Identity:92/377 - (24%)
Similarity:163/377 - (43%) Gaps:62/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFEGPLLPLHAATTSKDAKDSDSPSSELNIPYT--VFEVLVAIVSIIGNVLVIIVFRRERKLRRR 75
            |.:||..||.|..::.......:|||.:: .|.  |...|:..:|::||::|.::..|:|.|.:.
Zfish     7 SSDGPGNPLAAVVSTTGGVMGGAPSSAVS-TYVKLVLLGLIICISLVGNLVVSLLVLRDRALHKA 70

  Fly    76 TNYYIVSLAMADLLVGALGIPFAILA---SMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDR 137
            ..|:::.|.:||.:..|:..||.:::   ......::.:|.....:.|:.|..:.|.|..:||.|
Zfish    71 PYYFLLDLCLADTIRSAVCFPFVLVSIKNGSAWTYSVLSCKVVAFMAVLFCFHAAFMLFCISVTR 135

  Fly   138 YWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLF--GWHADVNHNQECLFVEVMDYNY-- 198
            |.||.:...||:.:...|.:.::.|.|.....:.|.|:|  |.:..:....:|:|    ::.|  
Zfish   136 YMAIAHHRFYSKRMTFWTCVAVVCMVWTLSVAMAFPPVFDVGTYKFIREEDQCIF----EHRYFK 196

  Fly   199 ----------LVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRR--------- 244
                      |..|..||.:....|:|..|.|       :..:.|.|.||  :|:.         
Zfish   197 ANDTLGFMLMLAVLILATHVVYMKLLLFEYKH-------RKMKPVQMVPA--ISQNWTFHGPGAT 252

  Fly   245 SSAAVVQVTTPGRGGHTGTML-----------RVLGAARKRDVKATQNLS----IIVLFFMICWI 294
            ..||...:...|||....|:|           |:||   ..:.||.:.|.    :|.|||::.|.
Zfish   253 GQAAANWIAGFGRGPMPPTLLGIRQNLHNQNRRLLG---MEEFKAEKQLGRMFYVITLFFLVLWS 314

  Fly   295 PLYTINCI-KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAAL 345
            | |.:.|. :.|...|.:..:.....:.:|...:.|||::..:..||.:..|
Zfish   315 P-YIVACYWRVFVKACTIPHRYLSTTVWMSFAQAGVNPIICFFLNKDLKKGL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 44/184 (24%)
7tm_1 58..334 CDD:278431 76/317 (24%)
gpr173NP_571573.1 7tm_4 45..>183 CDD:304433 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.