DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and PTGER2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_000947.2 Gene:PTGER2 / 5732 HGNCID:9594 Length:358 Species:Homo sapiens


Alignment Length:397 Identity:81/397 - (20%)
Similarity:153/397 - (38%) Gaps:103/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKDAKDSD-------SPSSELNIPYTVFEVLVAIVSIIGNVLVI-IVFRRER-----KLRRRTNY 78
            |.|::..|       .|.....|...:|.     ..::||::.: ::.||.|     ...||::.
Human     5 SNDSQSEDCETRQWLPPGESPAISSVMFS-----AGVLGNLIALALLARRWRGDVGCSAGRRSSL 64

  Fly    79 YIVSLAMADL----LVGALGIPFAILAS-------MGLPRNLHACLFTVSLLVVLCTISIFCLVA 132
            .:..:.:.:|    |:|...|...:|||       :.|.....||.:....:......::..|.|
Human    65 SLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFA 129

  Fly   133 VSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQEC----LFVEV 193
            ::::||.:|.:|..|.|.|.....:.::.:.:....:...|||..:...|   |.|    .|:..
Human   130 MALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYV---QYCPGTWCFIRH 191

  Fly   194 MDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTP--- 255
            ....||..  :||::  .||:::.....:.||:..:|.       ...||||...      |   
Human   192 GRTAYLQL--YATLL--LLLIVSVLACNFSVILNLIRM-------HRRSRRSRCG------PSLG 239

  Fly   256 -GRGGHTGTMLRVLGAARKRDVKATQN--------LSIIVLFFMICWIPLYTINCIKAFCPDCYV 311
             ||||         ..||:|..:.:..        |:|:.:.|.:|.:| :||        ..|:
Human   240 SGRGG---------PGARRRGERVSMAEETDHLILLAIMTITFAVCSLP-FTI--------FAYM 286

  Fly   312 H------PKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVA 370
            :      .|..|..:....:||.::|.::        |.|:..:|::|      ::....|.|:.
Human   287 NETSSRKEKWDLQALRFLSINSIIDPWVF--------AILRPPVLRLM------RSVLCCRISLR 337

  Fly   371 SQHRLQS 377
            :|...|:
Human   338 TQDATQT 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 39/188 (21%)
7tm_1 58..334 CDD:278431 67/314 (21%)
PTGER2NP_000947.2 7tm_1 38..314 CDD:278431 67/313 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..253 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.