| Sequence 1: | NP_651772.1 | Gene: | AdoR / 43583 | FlyBaseID: | FBgn0039747 | Length: | 774 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_000944.1 | Gene: | PTGDR / 5729 | HGNCID: | 9591 | Length: | 359 | Species: | Homo sapiens |
| Alignment Length: | 276 | Identity: | 51/276 - (18%) |
|---|---|---|---|
| Similarity: | 104/276 - (37%) | Gaps: | 60/276 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 IIGNVLVIIVFRR-------ERKLRRRTNYY---IVSLAMADLLVGALGIPFAILASMGLPRNL- 109
Fly 110 -----------HACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTR--------T 155
Fly 156 AIFIISMCWVAGTIVGFLPLFGWHADVNH--NQECLFVEVMDYNYLVFLYFATIITPALLMLAFY 218
Fly 219 THIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLS 283
Fly 284 IIVL---FFMICWIPL 296 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AdoR | NP_651772.1 | 7tm_4 | 52..>220 | CDD:304433 | 38/195 (19%) |
| 7tm_1 | 58..334 | CDD:278431 | 51/274 (19%) | ||
| PTGDR | NP_000944.1 | 7tmA_PGD2 | 17..335 | CDD:320268 | 51/276 (18%) |
| TM helix 1 | 18..44 | CDD:320268 | 3/12 (25%) | ||
| TM helix 2 | 61..87 | CDD:320268 | 8/26 (31%) | ||
| TM helix 3 | 105..135 | CDD:320268 | 6/32 (19%) | ||
| TM helix 4 | 147..169 | CDD:320268 | 5/29 (17%) | ||
| TM helix 5 | 195..224 | CDD:320268 | 3/30 (10%) | ||
| TM helix 6 | 258..288 | CDD:320268 | 5/24 (21%) | ||
| TM helix 7 | 302..327 | CDD:320268 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||