DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and npffr1l3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001082858.1 Gene:npffr1l3 / 561324 ZFINID:ZDB-GENE-070424-44 Length:412 Species:Danio rerio


Alignment Length:331 Identity:79/331 - (23%)
Similarity:155/331 - (46%) Gaps:53/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SPSSELNIP----YTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGI 95
            ||..:.::|    :::..:.:.::.::||.||.::..|.|.:|..||.:|::||::|||||...|
Zfish     7 SPYYQHSLPTAALFSLAYLFIFLLCLMGNALVCVIVLRNRHMRTVTNIFILNLAVSDLLVGIFCI 71

  Fly    96 PFAILASM--GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIF 158
            |..::.::  |.|.:...|..:..:..:..:.|:|.|||::|||:..|:||.      :.:..:|
Zfish    72 PTTLVDNLITGWPFSNTVCKLSGLVQGMSVSASVFTLVAIAVDRFRCIVYPF------KPKLTLF 130

  Fly   159 I----ISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATIITPALLML---A 216
            |    |...|:....:.|..:.....:.......::.:..:..|.::..:.|...|.:..:   .
Zfish   131 IAKVSIGTIWLLALTIMFPSVLMLTVEQERAHFMIYNDDQNNTYPLYSCYETWPDPEMRKIYTTV 195

  Fly   217 FYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQN 281
            .:.|||.:.:    .::.:......::..||||.:        |.       .|..||.::..:.
Zfish   196 LFLHIYVIPL----ALIMLMYGRIGAKLYSAAVSE--------HA-------NAQGKRKIRVVKM 241

  Fly   282 LSIIVLFFMICWIPLYTINCIKAFCPDCYVHPK------LTLFCIILSH----LNSAVNPVLYAY 336
            |.::.|.||:.|:||:|:..:..     |.||.      ||.:...|||    .||:|||::|.|
Zfish   242 LIMVALLFMLSWLPLWTLMMLTD-----YGHPDNDSLEILTSYIFPLSHWLAFSNSSVNPIIYGY 301

  Fly   337 HLKDFR 342
            ..::|:
Zfish   302 FNENFK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 41/176 (23%)
7tm_1 58..334 CDD:278431 73/294 (25%)
npffr1l3NP_001082858.1 7tm_4 28..>148 CDD:304433 37/125 (30%)
7tm_1 34..299 CDD:278431 73/294 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.