DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and tshr

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001139235.1 Gene:tshr / 560609 ZFINID:ZDB-GENE-110524-4 Length:757 Species:Danio rerio


Alignment Length:412 Identity:91/412 - (22%)
Similarity:167/412 - (40%) Gaps:98/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKDSDSPSSELNIPYTVFEV---LVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVG 91
            |.|..:|..:: :.::...|   .|::::::||:||::|..........:.:.:..||:|||   
Zfish   400 APDEFNPCEDI-MGFSFLRVSVWFVSLLAVLGNLLVLLVLLTSHYKLSVSRFLMCHLAVADL--- 460

  Fly    92 ALGIPFAILASMGLPRNL----HA--------CLFTVSLLVVLCTISIFCLVAVSVDRYWAILYP 144
            .:||...::||:.|....    ||        |.......|....:|::.|..::::|::||.|.
Zfish   461 CMGIYLLLIASVDLHTQSEYYNHAIDWQTGPGCSLAGFFSVFASELSVYTLTTITLERWYAITYA 525

  Fly   145 MAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLV-FLYFATII 208
            |...|.:|...|..|:.:.|:...::|.:||.|    |:..|:......||...|| .:|...::
Zfish   526 MRLDRKLRLSHASVIMLIGWIFCLLLGLMPLVG----VSSYQKVSICLPMDTQTLVDQIYIICVL 586

  Fly   209 TPALLMLAF------YTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRV 267
              .|.:|||      |..||..:         .||    |.:||                     
Zfish   587 --VLNILAFIVICVCYIKIYCAV---------HNP----SHQSS--------------------- 615

  Fly   268 LGAARKRDVKATQNLSIIVLFFMICWIP--LYTINCIKAFCPDCYVHPKLT-----LFCIILSHL 325
                 .:|....:.:::::....:|..|  ||.:..:       ..||.:|     :..::...|
Zfish   616 -----NKDTNIAKRMAVLIFTDFLCMAPISLYAMTAV-------LDHPLITVSNSKILLVLFYPL 668

  Fly   326 NSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVAS--------QHRLQSMDSNM 382
            ||..||.|||...|.|:..: .:||..:|: ..:||:.....:|:|        :|..:...:|.
Zfish   669 NSCANPFLYAIFTKAFQGDV-FILLSKVGL-CQRQAQLFRGQTVSSKASSRGITRHEREQTGANE 731

  Fly   383 RSTQPRLYVGEYSPIWLRQQQE 404
            .......:.|:.:   ..||||
Zfish   732 TPISLLDFPGKMA---AAQQQE 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 47/186 (25%)
7tm_1 58..334 CDD:278431 67/301 (22%)
tshrNP_001139235.1 leucine-rich repeat 52..75 CDD:275380
leucine-rich repeat 76..100 CDD:275380
LRR_5 101..224 CDD:290045
leucine-rich repeat 101..125 CDD:275380
leucine-rich repeat 145..175 CDD:275380
leucine-rich repeat 177..199 CDD:275380
leucine-rich repeat 200..224 CDD:275380
7tm_1 446..677 CDD:278431 62/285 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.