DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and or30by3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001034713.1 Gene:or30by3 / 554780 ZFINID:ZDB-GENE-010308-3 Length:328 Species:Danio rerio


Alignment Length:370 Identity:74/370 - (20%)
Similarity:138/370 - (37%) Gaps:113/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRN- 108
            |:| :.|.:..:.||:.:|.....|:.|::.|.....:||:.||..|.:.:|.|| |...:..| 
Zfish    39 TLF-LFVYLTLLGGNIFIIAFIAYEKSLQKPTYVIFCNLAVCDLTFGTVVLPQAI-AMYFININT 101

  Fly   109 --LHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVG 171
              .:.|...:..|..|..:|.|.::.:::||:.||..|:.|...:..:| :||  .|.|..|.: 
Zfish   102 ISFNLCFVQMFFLFCLSNVSSFIILLMTIDRFVAIRNPLRYCVLITNKT-VFI--ACGVIWTFI- 162

  Fly   172 FLPLFGWHADVNHNQECLFVEVM----------------DYNYLVFLYFA-TII----TPALLML 215
             .||..:....::::......|:                |....::|.|| |:|    .|..::.
Zfish   163 -TPLMAFIVYQSYDEPYCASNVVTQILCERNVVIKLSCRDIRQKLYLTFACTVIIVVGPPIFILC 226

  Fly   216 AF---YTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVK 277
            :|   :|.::.:...|.|.           :..|....|:                         
Zfish   227 SFIGIFTSVFNISNSQARY-----------KTFSTCFPQL------------------------- 255

  Fly   278 ATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYV--HPKLTL---FCIILSHLNSAVNPVLYAYH 337
                       |:||   |:.::.:..:..|..|  .|...:   .|..|  |...|||::|.:.
Zfish   256 -----------FLIC---LHFLSKLVVYVYDVTVTMSPSFRIAITLCSCL--LPPVVNPMIYCFK 304

  Fly   338 LKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSNM 382
            .|:.:.|::   :||                   :|::.||...|
Zfish   305 TKEIKDAIR---IKM-------------------RHKIVSMPVKM 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 44/194 (23%)
7tm_1 58..334 CDD:278431 62/307 (20%)
or30by3NP_001034713.1 7tm_4 41..312 CDD:304433 66/329 (20%)
7tm_1 51..301 CDD:278431 62/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.