DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ei24

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001017187.1 Gene:ei24 / 549941 XenbaseID:XB-GENE-990260 Length:340 Species:Xenopus tropicalis


Alignment Length:241 Identity:58/241 - (24%)
Similarity:92/241 - (38%) Gaps:67/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSITDFSFEGPLLPLHAATTSKDAKDSDSPS------SELNIPYT-VFEVL-VAIVSIIGNVLVI 63
            |.::.|.|....:||....|::...|   ||      |.|....| ||..| |..:.::..|:..
 Frog    82 FWLSLFLFYRMFIPLLQTVTARIIGD---PSLHGDVWSWLEFILTSVFSALWVLPLFVLSKVVNA 143

  Fly    64 IVFRR------ERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHACLF-------T 115
            |.|:.      |...|:...:..||..:||:|...|      |.::.|.:.:...||       .
 Frog   144 IWFQDIADLAFEMSGRKPQPFPSVSKIIADMLFNLL------LQALFLIQGMFVSLFPIDVIGQL 202

  Fly   116 VSLLVVLCTISIFCLV-------------AVSVDRYWAILYPMAYSRNVRTRTAI---FIISMCW 164
            :|||.:....|::|..             ..:::|.|.  |...:...:.:.||:   :|||.| 
 Frog   203 ISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP--YYFGFGLPLASLTAMQSSYIISGC- 264

  Fly   165 VAGTIVGFL-PLFGWHAD-------VNHNQECLFVEVMDYNYLVFL 202
                :...| |||...|:       |.|.|..||      :.:|||
 Frog   265 ----LFSILFPLFIISANEAKTPVKVYHFQLRLF------SLVVFL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/188 (22%)
7tm_1 58..334 CDD:278431 42/182 (23%)
ei24NP_001017187.1 EI24 120..254 CDD:399918 28/141 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.