DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Lpar2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_064412.2 Gene:Lpar2 / 53978 MGIID:1858422 Length:348 Species:Mus musculus


Alignment Length:351 Identity:77/351 - (21%)
Similarity:152/351 - (43%) Gaps:50/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSPSSELNIPYTVFEVL-------VAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVG 91
            ::...||::.:...:|:       |:::.::.|:|||......|:..:...|.:.:||.|||.. 
Mouse    15 NNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFA- 78

  Fly    92 ALGIPFAILASMGLPR----NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVR 152
              |:.:..|.....||    ::........||....|.|:..|:|::|:|:.:::....:||..|
Mouse    79 --GMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPR 141

  Fly   153 TRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAF 217
            .|....|:.: |.|...:|.||...||...:.:.....|.:...:||.....::::. .|||:|.
Mouse   142 GRVVTLIVGV-WAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLV-FLLMVAV 204

  Fly   218 YTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNL 282
            ||.|:..:.::|.::..........|.::.::|:           |::.:|||            
Mouse   205 YTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVK-----------TVVIILGA------------ 246

  Fly   283 SIIVLFFMICWIPLYTINCIKAF-CPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALK 346
                  |::||.|...:..:... |..|.| ..:..:.::|:..||.||.|:|:....:.|...:
Mouse   247 ------FVVCWTPGQVVLLLDGLDCKSCNV-LAVEKYFLLLAEANSLVNAVVYSCRDAEMRRTFR 304

  Fly   347 NLLLKMMGVDIDQQAEAIHRFSVASQ 372
            .||..|.   :...:....|:|.::|
Mouse   305 RLLCCMC---LRWSSHKSARYSASAQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/171 (25%)
7tm_1 58..334 CDD:278431 65/280 (23%)
Lpar2NP_064412.2 7tm_1 51..292 CDD:278431 62/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.