DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Taar3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001009532.1 Gene:Taar3 / 494319 RGDID:1359566 Length:342 Species:Rattus norvegicus


Alignment Length:319 Identity:78/319 - (24%)
Similarity:149/319 - (46%) Gaps:60/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHA------ 111
            :::|.||:::||.....::|...||:.|:|:|..|.|:|.:.:|::::      |::.:      
  Rat    43 VITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMV------RSVESCWYFGD 101

  Fly   112 --CLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLP 174
              |.|..|..::|...|||.|.::::||::|:..|:.|:..:.......::..||.|..:..| .
  Rat   102 SFCKFHASFDMMLSLTSIFHLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAAPALFSF-G 165

  Fly   175 LFGWHADVNHNQEC-LFVEVMDYNYLVF-------LYFATIITPALLMLAFYTHIYRVIIKQVRQ 231
            |....|:|:..|.. :.:...::..|.|       |:.....||..:|:..|..|:.|       
  Rat   166 LVLSEANVSGMQSYEILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIV------- 223

  Fly   232 IVTMNPASDLSRRSSAAV--VQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWI 294
                      |||.:.|:  :...|.|.|.:         .::|:|.||.:.|.|::..|:.||:
  Rat   224 ----------SRRHARALGNMPENTKGAGRN---------LSKKKDRKAAKTLGIVMGVFLACWL 269

  Fly   295 PLYTINCIKAFCPDCYVH---PKLTLFCII-LSHLNSAVNPVLYAYHLKDFRAALKNLL 349
            |     |..|...|.|:.   |.:.|..:: |.:.||..||:::.:....||.||::::
  Rat   270 P-----CFLAVLIDPYLDYSTPIIVLDLLVWLGYFNSTCNPLIHGFFYPWFRKALEHIV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 44/182 (24%)
7tm_1 58..334 CDD:278431 73/297 (25%)
Taar3NP_001009532.1 7tm_4 43..>190 CDD:304433 37/153 (24%)
7tm_1 48..307 CDD:278431 73/296 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.