DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and NPY1R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_000900.1 Gene:NPY1R / 4886 HGNCID:7956 Length:384 Species:Homo sapiens


Alignment Length:412 Identity:87/412 - (21%)
Similarity:171/412 - (41%) Gaps:95/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LHAATTSKDAKDSDSPSSELNIPYTVFEVL------VAIVSIIGNVLVIIVFRRERKLRRRTNYY 79
            :|:..:.|:|:.....:.:.::|..:...|      |.|:.:.||:.:||:..:::::|..||..
Human    14 VHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNIL 78

  Fly    80 IVSLAMADLLVGALGIPFAILASM------GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRY 138
            ||:|:.:||||..:.:||..:.::      |..    .|.....:..|..|:|||.||.::|:|:
Human    79 IVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEA----MCKLNPFVQCVSITVSIFSLVLIAVERH 139

  Fly   139 WAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLY 203
            ..|:.|..:..|  .|.|...|::.||. .:...||...:....:...:.:.::.....|:.|..
Human   140 QLIINPRGWRPN--NRHAYVGIAVIWVL-AVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQ 201

  Fly   204 FAT-----IITPALLMLAFYTHI-------YRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPG 256
            |.:     ..|..||:|.::..:       :::.|:..|:...|:...|...|||          
Human   202 FPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSS---------- 256

  Fly   257 RGGHTGTMLRVLGAARKRDVKATQNLSI----IVLFFMICWIPLYTINC-------IKAFCPDCY 310
                                 .|:.::|    ||:.|.:||:||...|.       |.|.|.   
Human   257 ---------------------ETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCN--- 297

  Fly   311 VHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAAL----------------KNLLLKMMGVDIDQ 359
             |..|.|.|.:.:.:::.|||:.|.:..|:|:..|                :.:.:..|..|:.:
Human   298 -HNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK 361

  Fly   360 QAEAIHRFSVASQHRLQSMDSN 381
              .::.:.|..:..::.:.|.|
Human   362 --TSLKQASPVAFKKINNNDDN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 45/178 (25%)
7tm_1 58..334 CDD:278431 71/304 (23%)
NPY1RNP_000900.1 7tm_4 52..>176 CDD:304433 38/130 (29%)
7tm_1 57..320 CDD:278431 71/304 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.