DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and MTNR1B

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_005950.1 Gene:MTNR1B / 4544 HGNCID:7464 Length:362 Species:Homo sapiens


Alignment Length:321 Identity:80/321 - (24%)
Similarity:142/321 - (44%) Gaps:59/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILA------SMGLPR 107
            ::...|.::||:|||:...|.||||...|.::||||:|||:|.....|..::|      ::| ..
Human    48 IVTTAVDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALG-EE 111

  Fly   108 NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGF 172
            :..|..|.:.|.|:   .|:|.:.|::::||..|.:.|||.|..|.......|.:.|:. |:|..
Human   112 HCKASAFVMGLSVI---GSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLL-TVVAL 172

  Fly   173 LPLFGWHADVNHN---QECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVT 234
            ||.| :...:.::   ..|.|::.....|...:.....:.|..::...|..|: |::.|.|:  .
Human   173 LPNF-FVGSLEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIW-VLVLQARR--K 233

  Fly   235 MNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTI 299
            ..|.|.|..:.|                            |:::...:.::.:.|.|||.||   
Human   234 AKPESRLCLKPS----------------------------DLRSFLTMFVVFVIFAICWAPL--- 267

  Fly   300 NCI--------KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKM 352
            |||        :...|.  :...|.:...:|::.||.:|.::|....::||...|.:||.:
Human   268 NCIGLAVAINPQEMAPQ--IPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRILLAL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/176 (28%)
7tm_1 58..334 CDD:278431 73/292 (25%)
MTNR1BNP_005950.1 7tm_4 48..>192 CDD:304433 46/149 (31%)
7tm_1 57..308 CDD:278431 73/292 (25%)
7tm_4 <131..>261 CDD:304433 30/162 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.