DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Lgr3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_733115.1 Gene:Lgr3 / 43098 FlyBaseID:FBgn0039354 Length:765 Species:Drosophila melanogaster


Alignment Length:405 Identity:78/405 - (19%)
Similarity:144/405 - (35%) Gaps:127/405 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPLHAATT---------------SKDAKDSDSPSSELNIPYTVFE------------------- 48
            |:|:|.:::               ..|..|.::.:|..|:.|.:::                   
  Fly   355 LMPIHISSSLMEPLNISFLNLTGIRYDHIDFEAINSMRNLTYIIYDRFFYCSMTPRVRMCKPSTD 419

  Fly    49 ------------VL------VAIVSIIGNVLVI---IVFRRERKLRRRTNYYIVSLAMADLLVGA 92
                        ||      :|.::|.|||||:   .::|.|..   .....|.:||:||:|:| 
  Fly   420 GVSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENV---AVTMVIRNLALADMLMG- 480

  Fly    93 LGIPFAILASMGLP----RNLH-----------ACLFTVSLLVVLCTISIFCLVAVSVDRYWAIL 142
                 ..|.::|:.    ||.:           .|....:|.|....:|:..|..:|::|:..|.
  Fly   481 -----FYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLERFLLIA 540

  Fly   143 YPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADV-----NHNQECLFVEVMDYNYLVFL 202
            .|....|::..|.....:...|:.|..:...|:..|....     :::..|..:.:.:...:.:|
  Fly   541 DPFRGHRSIGNRVMWLALICIWITGVGLAVAPVLLWRTSTLPYYGSYSGTCFPLHIHEAFPMGWL 605

  Fly   203 YFATIITPA-LLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLR 266
            |.|.:.... ||:|.....:|..::..:.:..:..|.                        |:| 
  Fly   606 YSAFVFLGVNLLLLVMIAMLYTALLISIWRTRSATPL------------------------TLL- 645

  Fly   267 VLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAF----CPDCYVHPKLTLFCIILSHLNS 327
                    |.:.......|||...:||:|:..:.....|    ..|.|..  |.:|.:   .|||
  Fly   646 --------DCEFAVRFFFIVLTDFLCWVPIIVMKIWVFFNYNISDDIYAW--LVVFVL---PLNS 697

  Fly   328 AVNPVLYAYHLKDFR 342
            ||||:||.:....:|
  Fly   698 AVNPLLYTFTTPKYR 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/191 (22%)
7tm_1 58..334 CDD:278431 63/303 (21%)
Lgr3NP_733115.1 LDLa 32..65 CDD:238060
LRR_8 179..239 CDD:290566
leucine-rich repeat 181..204 CDD:275380
LRR_RI <196..354 CDD:238064
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
leucine-rich repeat 253..275 CDD:275380
LRR_8 274..334 CDD:290566
leucine-rich repeat 276..299 CDD:275380
leucine-rich repeat 300..323 CDD:275380
leucine-rich repeat 324..347 CDD:275380
7tm_1 447..704 CDD:278431 63/303 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.