DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Octbeta1R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:408 Identity:114/408 - (27%)
Similarity:180/408 - (44%) Gaps:108/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GPLLPLHAATTSKDAKDSDSPSSELNIPYTVFEVL--VAIVSIIGNVLVIIVFRRERKLRRRTNY 78
            |....:.|:..|.|  |:|. ||.|.:.:....::  :.:.:|:||:|||:...|.||||..|||
  Fly    83 GQAQDIQASEGSTD--DADG-SSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNY 144

  Fly    79 YIVSLAMADLLVGALGIPFAILASMGLPRNLHACLFTVSLLV--------VLC-----------T 124
            ::||||:||:||.                 |.|..|..|:::        |:|           |
  Fly   145 FVVSLAVADMLVA-----------------LCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFST 192

  Fly   125 ISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL-FGWHADVNHNQEC 188
            .||..|..:|||||:||:.|:.|...:..|....::.|.|::..::.|||: .||:....     
  Fly   193 ASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTE----- 252

  Fly   189 LFVEVMDYNYL----------VFLYFATIIT------PALLMLAFYTHIYRVIIKQVRQIVTMNP 237
                  :|.||          |...:|.:.:      |.::||:.|..||:...:|.|.:.....
  Fly   253 ------NYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKV 311

  Fly   238 ASDL-----------SRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMI 291
            |:.|           ..|.|..|.|.|       ..||        :|:.||.:.|.||:..|:|
  Fly   312 AALLLEKHLQISQIPKPRPSIQVEQST-------ISTM--------RRERKAARTLGIIMSAFLI 361

  Fly   292 CWIPLYTINCIKAFCPDCYVHPKLTLFCII-LSHLNSAVNPVLYAYHLKDFRAALKNLLLKMM-- 353
            ||:|.:....:.:.|..| :.|:|.:..:. :.:.|||:||::|||..:|||||.|..|..:.  
  Fly   362 CWLPFFLWYIVSSLCDSC-ITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPY 425

  Fly   354 ---------GVDIDQQAE 362
                     |.|.|:..|
  Fly   426 AFYFCRRGRGRDDDRDLE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 58/203 (29%)
7tm_1 58..334 CDD:278431 90/323 (28%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 42/135 (31%)
7tm_1 124..404 CDD:278431 90/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.