DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ninaE

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster


Alignment Length:369 Identity:83/369 - (22%)
Similarity:142/369 - (38%) Gaps:82/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLHAATTSKDAKDSDSPS-SELNIPY---------------TVFEVLVAIVSIIGNVLVIIVFRR 68
            |..|..::....|..:|. :.|..||               |.:.:::.::|..||.:||.:|..
  Fly    13 PHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFAT 77

  Fly    69 ERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHACLFTVSLLVVLCTI-------- 125
            .:.||...|..:::||::|     .||.......||:  ||:  ..|..|..::|.|        
  Fly    78 TKSLRTPANLLVINLAISD-----FGIMITNTPMMGI--NLY--FETWVLGPMMCDIYAGLGSAF 133

  Fly   126 ---SIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADV-NHNQ 186
               ||:.:..:|:|||..|:..|| .|.:....|:..|:..|...:|....|.|||...| ..|.
  Fly   134 GCSSIWSMCMISLDRYQVIVKGMA-GRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNL 197

  Fly   187 ECLFVEVM--DYN---YLVFLYFATIITPALLMLAFYTHIYRVII---KQVRQ------IVTMNP 237
            ....::.:  |:|   ||:|........|..|:...|..|...:.   |.:|:      :.::..
  Fly   198 TSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRS 262

  Fly   238 ASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCI 302
            :.|..:.:...:.:|.                            |..|.|:|| .|.|...|||:
  Fly   263 SEDAEKSAEGKLAKVA----------------------------LVTITLWFM-AWTPYLVINCM 298

  Fly   303 KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALK 346
            ..|..: .:.|..|::....:...:..||::|......:|.|||
  Fly   299 GLFKFE-GLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/184 (27%)
7tm_1 58..334 CDD:278431 69/301 (23%)
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 73/327 (22%)
TM helix 1 53..77 CDD:320207 7/23 (30%)
TM helix 2 86..108 CDD:320207 6/26 (23%)
TM helix 3 124..146 CDD:320207 3/21 (14%)
TM helix 4 168..184 CDD:320207 3/15 (20%)
TM helix 5 212..235 CDD:320207 5/22 (23%)
TM helix 6 275..297 CDD:320207 9/50 (18%)
TM helix 7 308..333 CDD:320207 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.