DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and MC5R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_005904.1 Gene:MC5R / 4161 HGNCID:6933 Length:325 Species:Homo sapiens


Alignment Length:363 Identity:77/363 - (21%)
Similarity:146/363 - (40%) Gaps:92/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TDFSFEGPLLPLHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRR 74
            |:.:..||           :.|:..||..::.|...|| :.:.::|::.|:|||....:.:.|..
Human    17 TEGNLSGP-----------NVKNKSSPCEDMGIAVEVF-LTLGVISLLENILVIGAIVKNKNLHS 69

  Fly    75 RTNYYIVSLAMADLLVG-----------ALGIPFAILASMGLPR--NLHACLFTVSLLVVLCTIS 126
            ...:::.|||:||:||.           .|.....::|...:..  |:...:..:|::..:|:  
Human    70 PMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCS-- 132

  Fly   127 IFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFV 191
               |:|::||||..|.|.:.|...:..|.:..||:..|...|..|.                :|:
Human   133 ---LLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGI----------------VFI 178

  Fly   192 EVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPG 256
            ...:..|::....:.......|:::.|.|::.:....|::|..:..||...:|:|.         
Human   179 LYSESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSM--------- 234

  Fly   257 RGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFC-- 319
            :|..|.|||  ||.                  |.:||.|.:....:...||.       .|:|  
Human   235 QGAVTVTML--LGV------------------FTVCWAPFFLHLTLMLSCPQ-------NLYCSR 272

  Fly   320 --------IILSHLNSAVNPVLYAYHLKDFRAALKNLL 349
                    :||...||.::|::||:..::.|...|.::
Human   273 FMSHFNMYLILIMCNSVMDPLIYAFRSQEMRKTFKEII 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 37/180 (21%)
7tm_1 58..334 CDD:278431 63/298 (21%)
MC5RNP_005904.1 7tm_4 43..>167 CDD:304433 31/129 (24%)
7tm_1 53..295 CDD:278431 63/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.