DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and MC3R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_063941.3 Gene:MC3R / 4159 HGNCID:6931 Length:323 Species:Homo sapiens


Alignment Length:364 Identity:84/364 - (23%)
Similarity:151/364 - (41%) Gaps:76/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLLP-----LHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRT 76
            |.||     |.|...|.  :.|.:...::.|...|| :.:.|||::.|:|||:...|...|....
Human    12 PTLPNGSEHLQAPFFSN--QSSSAFCEQVFIKPEVF-LSLGIVSLLENILVILAVVRNGNLHSPM 73

  Fly    77 NYYIVSLAMADLLVGALG----IPFAILASMGLP---------RNLHACLFTVSLLVVLCTISIF 128
            .:::.|||:||:||....    |..||:.|..|.         .|:...:..:||:..:|.    
Human    74 YFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICN---- 134

  Fly   129 CLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEV 193
             |:|::||||..|.|.:.|...:..|.|:.:|...||...:.|.:.:      |....:.:.|  
Human   135 -LLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI------VYSESKMVIV-- 190

  Fly   194 MDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRG 258
                .|:.::||.:    |||...|.|::......|::|..:.||..::.:..:.          
Human   191 ----CLITMFFAMM----LLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSC---------- 237

  Fly   259 GHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPD-----CYVHPKLTLF 318
                             :|....::|::..|:.||.|.:....:...||.     ||.....|..
Human   238 -----------------MKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYL 285

  Fly   319 CIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDI 357
            .:|:  .||.::|::||:...:.|...:.:|....|:::
Human   286 VLIM--CNSVIDPLIYAFRSLELRNTFREILCGCNGMNL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 49/180 (27%)
7tm_1 58..334 CDD:278431 66/293 (23%)
MC3RNP_063941.3 7tm_4 45..>170 CDD:304433 38/130 (29%)
7tm_1 55..299 CDD:278431 66/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.