powered by:
Protein Alignment AdoR and slc30a7
DIOPT Version :9
Sequence 1: | NP_651772.1 |
Gene: | AdoR / 43583 |
FlyBaseID: | FBgn0039747 |
Length: | 774 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_989256.1 |
Gene: | slc30a7 / 394867 |
XenbaseID: | XB-GENE-977014 |
Length: | 390 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 15/75 - (20%) |
Similarity: | 24/75 - (32%) |
Gaps: | 9/75 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 601 AGNSNSAHCLPGSTASPAPQEQSGIFVIDSEASPGSNGHKPKYRKGTAFTRSSLKKSRSCNCSSI 665
:|:.:|.....||.:........| ....:..|.:||...:.:|...:.....| ...
Frog 171 SGHGHSHSLFNGSLSHGHSHSHGG---SHGHSHGGGHGHSHSHGEGHGHSHDQSHK------HGH 226
Fly 666 AKGRGVHDEP 675
..|...||||
Frog 227 GYGSSCHDEP 236
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BF5B |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.860 |
|
Return to query results.
Submit another query.