DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and slc30a7

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_989256.1 Gene:slc30a7 / 394867 XenbaseID:XB-GENE-977014 Length:390 Species:Xenopus tropicalis


Alignment Length:75 Identity:15/75 - (20%)
Similarity:24/75 - (32%) Gaps:9/75 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 AGNSNSAHCLPGSTASPAPQEQSGIFVIDSEASPGSNGHKPKYRKGTAFTRSSLKKSRSCNCSSI 665
            :|:.:|.....||.:........|   ....:..|.:||...:.:|...:.....|      ...
 Frog   171 SGHGHSHSLFNGSLSHGHSHSHGG---SHGHSHGGGHGHSHSHGEGHGHSHDQSHK------HGH 226

  Fly   666 AKGRGVHDEP 675
            ..|...||||
 Frog   227 GYGSSCHDEP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433
7tm_1 58..334 CDD:278431
slc30a7NP_989256.1 CzcD 35..386 CDD:224151 15/75 (20%)
His-rich loop 161..226 10/63 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..243 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BF5B
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.