DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ptger2a

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_956929.1 Gene:ptger2a / 393608 ZFINID:ZDB-GENE-040426-1321 Length:281 Species:Danio rerio


Alignment Length:309 Identity:67/309 - (21%)
Similarity:123/309 - (39%) Gaps:74/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVF---RRERKLRRRTNYY---IVSLAMADLLVGA 92
            ||.:.|.|....:..::.| ...|||||.:::.   ||:.|.|:|.:.:   :.:|.:.||....
Zfish    10 DSVNVEQNGGPAISALMFA-AGAIGNVLALVLLEFRRRKEKNRQRQSLFHLLVTTLVITDLTGTC 73

  Fly    93 LGIPFAILASM------GLPRNLHACL---FTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYS 148
            |..|....|.:      |:.:....|.   |.::.| .|.|:||  |:|::::|..:|.||..|.
Zfish    74 LTSPVVQTAYLTNTTLVGMSKTHAVCEYFGFAMTFL-SLATLSI--LLAMALERCISIGYPYHYG 135

  Fly   149 RNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNH----------NQECLFVEVMDYNY----- 198
            |::..|.....|...::|..:...:|..|:...|.:          |.|    |:.|..|     
Zfish   136 RHITKRCGYITIPCIYLACFLFCLMPFAGFGKYVQYCPGTWCFIAMNSE----EIEDRAYANVYA 196

  Fly   199 LVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGT 263
            .|.|:...||......:     :|.:::...|:.:........|:|:.                 
Zfish   197 TVMLFIMIIIVVCNCFV-----VYHLVLMYRRRKMNRGSVQTRSKRNR----------------- 239

  Fly   264 MLRVLGAARKRDVKATQNLSIIV---LFFMICWIPLYTINCIKAFCPDC 309
              |....|.:     .::|.::|   :.|:||::||    .::....||
Zfish   240 --RYFSWAEE-----VEHLILLVFMTVIFVICFLPL----IVRFIVCDC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 48/197 (24%)
7tm_1 58..334 CDD:278431 61/285 (21%)
ptger2aNP_956929.1 7tm_4 <101..>242 CDD:304433 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.