DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Rxfp1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_997617.1 Gene:Rxfp1 / 381489 MGIID:2682211 Length:758 Species:Mus musculus


Alignment Length:482 Identity:101/482 - (20%)
Similarity:179/482 - (37%) Gaps:149/482 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSDSPSSELNIPYTVFE-VLVAIVSII---GNVLVIIV---FRRERKLRRRTNYYIVSLAMADLL 89
            ::|..||..|:..::.: |.|.:||.|   ||:.||.:   .|.|.||...:   |:||..||.|
Mouse   392 NTDGISSLENLLASIIQRVFVWVVSAITCFGNIFVICMRPYIRSENKLHAMS---IISLCCADCL 453

  Fly    90 VGALGIPFAILASMGL----PRNLHA--------CLFTVSLLVVLCTISIFCLVAVSVDRYWAIL 142
               :|:...::.:..|    ..|.||        |.|..||.::...:|:..|..:::::|..|:
Mouse   454 ---MGVYLFVIGAFDLKFRGEYNKHAQPWMESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIV 515

  Fly   143 YPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL-----FGWHADVN------HNQECLFVEVMDY 196
            ||....|..:.|| |.::...|:.|.||.|.||     |..:...|      |:::........|
Mouse   516 YPFRCLRPRKCRT-ITVLIFIWIIGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIY 579

  Fly   197 NYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHT 261
            :.::||.. .::...:::.::.:..|.|                  .:||..|.::.        
Mouse   580 SVVIFLGI-NLVAFIIIVFSYGSMFYSV------------------HQSSVTVTEIQ-------- 617

  Fly   262 GTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYT---INCIKAFCPDCYVHPKLTLFCII-L 322
                    ...|::|...:....||....:||||::.   ::.::...||     .:|.:.:| :
Mouse   618 --------KQVKKEVVLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPD-----SITSWVVIFI 669

  Fly   323 SHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSNMRSTQP 387
            ..:|||:||::|....:.|:                   |.||:.    .|..:...|..|....
Mouse   670 LPINSALNPIIYTLTTRPFK-------------------EMIHQL----WHNYRQRRSVDRKETQ 711

  Fly   388 RLYVGEYSPIWLRQQQEALKNSQLLPKCGVVSPCFNNINQTVAAVASVTTDLEREMWNIVEASSG 452
            :.|...:  ||:                                          |||.:.|.|||
Mouse   712 KAYAPSF--IWV------------------------------------------EMWPLQEMSSG 732

  Fly   453 AELGETSYEFPSPAPGSQRSSERNSSS 479
            . :...::..|.......:||..||.|
Mouse   733 F-MKPGAFTDPCDLSLVSQSSRLNSYS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 49/196 (25%)
7tm_1 58..334 CDD:278431 68/305 (22%)
Rxfp1NP_997617.1 LDLa 27..62 CDD:238060
leucine-rich repeat 110..127 CDD:275378
LRR 1 127..148
leucine-rich repeat 128..151 CDD:275380
LRR_RI 147..331 CDD:238064
LRR_8 151..210 CDD:290566
LRR 2 151..172
leucine-rich repeat 152..175 CDD:275380
LRR 3 175..196
leucine-rich repeat 176..199 CDD:275380
LRR_8 199..259 CDD:290566
LRR 4 199..220
leucine-rich repeat 200..223 CDD:275380
LRR 5 223..244
leucine-rich repeat 224..248 CDD:275380
LRR 6 248..269
leucine-rich repeat 249..272 CDD:275380
LRR_8 272..331 CDD:290566
LRR 7 272..293
leucine-rich repeat 273..296 CDD:275380
LRR 8 296..317
leucine-rich repeat 297..320 CDD:275380
LRR 9 320..341
leucine-rich repeat 321..344 CDD:275380
LRR 10 344..365
leucine-rich repeat 345..366 CDD:275380
7tm_1 422..681 CDD:278431 68/305 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.