DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and CCHa1-R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:461 Identity:110/461 - (23%)
Similarity:192/461 - (41%) Gaps:93/461 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SFEGPLLPLHAATTSKDAKDSDSPSSELNIPY---------TVFEVLVAIVSIIGNVLVIIVFRR 68
            |.:.|||...::....:...:::|    .:||         .:...|:.:|.::||..:|:||..
  Fly    48 STQWPLLDTGSSENFSELVTTETP----YVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLS 108

  Fly    69 ERKLRRRTNYYIVSLAMADLLVGALGIPFA--ILASMGLPRNLHACLFTVSLLVVLCTISIFCLV 131
            .|::|...|.||:|||:|||||....:|.|  :......|.....|..:..:..|...:|:|.|.
  Fly   109 VRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLT 173

  Fly   132 AVSVDRYWAILYPM----AYSRNVR-TRTAIFIISMCWVAGTIVGFLPLFGWHADVNH---NQEC 188
            |:|.|||:||:.|:    |:....| ||..:......|:...:.|...|.|  :::.|   |::.
  Fly   174 ALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIG--SNLKHLGINEKS 236

  Fly   189 LFV-----EVMDYNY---LVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRS 245
            :.:     |....||   :|.|:|.......|:::|    ::.|:|.             |....
  Fly   237 IVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIA----VFYVLIA-------------LHLMY 284

  Fly   246 SAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFM----ICWIPLYTINCIKAFC 306
            ||:|     ||         .:.||.|:  |:|.:.:::.||.|:    ||::|.:.......|.
  Fly   285 SASV-----PG---------EIQGAVRQ--VRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFW 333

  Fly   307 P------DCYVHP-KLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAI 364
            |      :.:.|. ::..:|  :|..||..|||...:....||... |..|...|....::....
  Fly   334 PTAQDDYNAFWHVLRIVAYC--MSFANSCANPVALYFVSGAFRKHF-NRYLFCRGASGRRKKRGQ 395

  Fly   365 HRFSVASQHRLQSMDSNMRSTQPRLYVGEYSPIWLRQQQEALKNSQLLPKCGVVSPCFNNINQTV 429
            |  .....||    |:::.||..:.:...:|     ..|..:::.:|........|  |..||..
  Fly   396 H--DTFCMHR----DTSLTSTASKRFQSRHS-----CYQSTIRSCRLQETTITTLP--NGGNQNG 447

  Fly   430 AAVASV 435
            |.:::|
  Fly   448 ANISAV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 53/185 (29%)
7tm_1 58..334 CDD:278431 81/304 (27%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 36/99 (36%)
7tm_1 98..364 CDD:278431 79/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.