DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and lpar1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001004502.2 Gene:lpar1 / 368461 ZFINID:ZDB-GENE-030616-499 Length:346 Species:Danio rerio


Alignment Length:341 Identity:78/341 - (22%)
Similarity:147/341 - (43%) Gaps:55/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPR----NL 109
            :.|.|..::.|:||::.....|:......|.:.:||.||...|.  ..|.::.:.| |.    .:
Zfish    39 ITVCIFIMLANLLVMVAIYINRRFHFPIYYLMANLAAADFFAGL--AYFYLMFNTG-PNTRRLTV 100

  Fly   110 HACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLP 174
            ...|....|:....|.|:..|:|::::|:..:.....::| :..|..:.:|.:.|....::|.:|
Zfish   101 STWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTR-MSNRRVVVVIVIIWTMSIVMGAIP 164

  Fly   175 LFGWHA----DVNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTM 235
            ..||:.    |...|...|:    ..:||.|.....::| .::|:..|.||:..:.::     ||
Zfish   165 SVGWNCICAIDTCSNMAPLY----SNSYLGFWAIFNLVT-FVVMVVLYAHIFMYVRQR-----TM 219

  Fly   236 NPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLF--FMICWIPLYT 298
            .    :||.||                      |..|.||...:...:::::.  |::||.|...
Zfish   220 R----MSRHSS----------------------GQRRNRDTMMSLLKTVVIVLGAFIVCWTPGLV 258

  Fly   299 INCIKAFCPDCYVHPKLTL--FCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQA 361
            |..:...|.:|.|   ||.  |.::|:..|||:||::|:|..|:.....|.:|......:::..|
Zfish   259 ILLLDVVCANCNV---LTYEKFFLLLAEFNSAMNPIIYSYRDKEMSITFKQILCCQRQENVNGTA 320

  Fly   362 EAIHRFSVASQHRLQS 377
            |...|.:.:..|.:.|
Zfish   321 EGSDRSASSINHTVLS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 38/175 (22%)
7tm_1 58..334 CDD:278431 66/287 (23%)
lpar1NP_001004502.2 7tm_1 49..293 CDD:278431 66/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.