DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and srw-42

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001023799.1 Gene:srw-42 / 3565714 WormBaseID:WBGene00005789 Length:382 Species:Caenorhabditis elegans


Alignment Length:374 Identity:75/374 - (20%)
Similarity:144/374 - (38%) Gaps:81/374 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAKDSDSPSSELNIPYTVF-----------EVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVS 82
            |:|.....|:...:.:.||           .|::::|....|:..:.|..|:.........:::.
 Worm    11 DSKFDADESNNFLVSFEVFVGKLEQYIDLASVVISVVGFFTNIFHLAVLTRKSIRNSSVFIFLIG 75

  Fly    83 LAMADL------LVGALGIPFAILASMGL------PRNLHACLFTV---SLLVVLCTISIFCLVA 132
            :|:.||      :|....|.:.:|.|:.:      ||:..|.:|.:   .|.::...:|::..|.
 Worm    76 IAICDLVRMISIIVSKSPIFYRVLLSLFIDSTCFTPRSYLAMIFDLISNILEIISLDLSVWLAVF 140

  Fly   133 VSVDRYWAILYPMAYSRNVRTRTAIFIIS-MCWVAGTIVGFLPLFG--------------WHADV 182
            :::.|...|.||.    |.|..:.:...| :|.|....:...| ||              |    
 Worm   141 MTIFRVLVIRYPF----NKRISSLVTSKSGLCTVIPLSIIIFP-FGLLYYFQVTIRPVSIW---- 196

  Fly   183 NHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYT--HIYRVIIKQVRQIVTMNPASDLSRRS 245
            ..:.:||..: .::..:.:.:.||.::..|......|  |:..|:.|.:..||       |...:
 Worm   197 KPSSDCLGFQ-SNFFQINYKFSATELSGVLGTDTIETMIHVDGVLFKLIPSIV-------LLVAT 253

  Fly   246 SAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKA-TQNLSIIVLF-FMICWIP---LYTINCIKAF 305
            |..|.::..     |..|    :.|.|.:..|. |..|...|.| |:|..:|   .|.|....|.
 Worm   254 SVLVFEIRK-----HKKT----IWAQRNKSNKDWTTKLVFFVTFTFLIAIVPQGIAYIIMFKMAE 309

  Fly   306 CPDCYV----HPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLL 350
            .|...:    .|.:..|   ||.:|..::.:::.:...::|...|::.|
 Worm   310 IPILRIIAMSLPSVFSF---LSVVNGTIHFLIFYFMSSEYRMTAKHMCL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 37/199 (19%)
7tm_1 58..334 CDD:278431 65/316 (21%)
srw-42NP_001023799.1 TM helix 1 37..61 CDD:320109 4/23 (17%)
7TM_GPCR_Srw 40..357 CDD:370978 70/345 (20%)
TM helix 2 70..100 CDD:320109 5/29 (17%)
TM helix 3 121..143 CDD:320109 3/21 (14%)
TM helix 4 164..180 CDD:320109 4/16 (25%)
TM helix 5 231..254 CDD:320109 7/29 (24%)
TM helix 6 277..302 CDD:320109 7/24 (29%)
TM helix 7 318..343 CDD:320109 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.