DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and CCHa2-R

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster


Alignment Length:332 Identity:86/332 - (25%)
Similarity:138/332 - (41%) Gaps:76/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IPY------------TVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALG 94
            :||            ||...|:.||.::||..::|:|.|.|.:|...|.||:|||:|||||..:.
  Fly    58 VPYVPVLDRPETYIVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALADLLVILVC 122

  Fly    95 IPFAILA----SMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTR- 154
            :|.|.:.    |....||:  |..:.....:...:|:|.|.|:|.:||.||:.|:   |.::|: 
  Fly   123 VPVATIVYTQESWPFERNM--CRISEFFKDISIGVSVFTLTALSGERYCAIVNPL---RKLQTKP 182

  Fly   155 TAIFIISMCWVAGTIVGF----------LPLFGWHADVNHNQECLFVEV----MDYNYLVFLYFA 205
            ..:|...|.|:...::|.          .|:|....::.       :||    .|..|..|:...
  Fly   183 LTVFTAVMIWILAILLGMPSVLFSDIKSYPVFTATGNMT-------IEVCSPFRDPEYAKFMVAG 240

  Fly   206 TIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGA 270
            ..:...||.|:....:|.::.|::.......|....|.:|..                      .
  Fly   241 KALVYYLLPLSIIGALYIMMAKRLHMSARNMPGEQQSMQSRT----------------------Q 283

  Fly   271 ARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCP-------DCYVHPKLTLFCIILSHLNSA 328
            ||.|...|...::.:|:|| ||:.|.:.......|.|       :.:...::..||  .|.|||.
  Fly   284 ARARLHVARMVVAFVVVFF-ICFFPYHVFELWYHFYPTAEEDFDEFWNVLRIVGFC--TSFLNSC 345

  Fly   329 VNPV-LY 334
            |||| ||
  Fly   346 VNPVALY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 52/186 (28%)
7tm_1 58..334 CDD:278431 77/302 (25%)
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 84/320 (26%)
TM helix 1 71..97 CDD:320593 9/25 (36%)
TM helix 2 104..130 CDD:320593 13/25 (52%)
TM helix 3 142..172 CDD:320593 9/29 (31%)
TM helix 4 182..202 CDD:320593 4/19 (21%)
TM helix 5 234..259 CDD:320593 5/24 (21%)
TM helix 6 285..315 CDD:320593 9/30 (30%)
TM helix 7 330..355 CDD:320593 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.