DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Gpbar1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_808797.1 Gene:Gpbar1 / 338443 RGDID:631400 Length:329 Species:Rattus norvegicus


Alignment Length:378 Identity:88/378 - (23%)
Similarity:142/378 - (37%) Gaps:100/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSELN-IPYTVFEVLVAIVS--IIGNVLVIIVFRRERKLRR-RTNYYIVSLAMADLLVGALGIPF 97
            ::||: ||..|.|:.:.:.|  :|.|:|:.:....:|.||. ....:.:||.:|.||.| |.:| 
  Rat     6 TTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTG-LALP- 68

  Fly    98 AILASMGLPRNLH----ACLFTVSLLVVLCTISIFC-LVAVSVDRYWAILYPMAYSRNVRTRTAI 157
               ...||....|    :||. :.|....|.:|:.. |:.|..:||.|:|.|:....:|  |.|:
  Rat    69 ---TLPGLWNRSHQGYWSCLL-LHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSV--RLAL 127

  Fly   158 FIISMCWVAGTIVGFLPLFGWHADVNH---NQECLFVEVMDYNYLVFLYFATIITPALLMLAFYT 219
            |   :.|::..:...||..||    ||   ...|....:....||                  |.
  Rat   128 F---LTWISSLLFASLPALGW----NHWSPGANCSSQAIFPAPYL------------------YL 167

  Fly   220 HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSI 284
            .:|.:::..|               .:.|::.|.......|....:|.|..|..||..:|...::
  Rat   168 EVYGLLLPAV---------------GATALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARAL 217

  Fly   285 ----------IVLFFMICWIP-----LYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLY 334
                      ..|.|::||.|     |.::...:...|   :.|...|..|.|...::||.||  
  Rat   218 TWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPP---LGPVTLLSLISLGSASAAVVPV-- 277

  Fly   335 AYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSNMRSTQP 387
                             .||:. ||:..|..|  .|:|..||.:....:...|
  Rat   278 -----------------AMGLG-DQRYTAPWR--TAAQRWLQVLRGRPKRANP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 45/178 (25%)
7tm_1 58..334 CDD:278431 69/299 (23%)
Gpbar1NP_808797.1 7tm_1 <108..249 CDD:278431 37/182 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..329 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.