DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Taar9

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_783192.1 Gene:Taar9 / 319107 RGDID:631383 Length:338 Species:Rattus norvegicus


Alignment Length:354 Identity:93/354 - (26%)
Similarity:143/354 - (40%) Gaps:92/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGI 95
            |.|.||.... |.|.|.. |.|::::.||:|||......::|...||:.:.|||.||.|||...:
  Rat    14 KSSYSPWPRA-ILYAVLG-LGALLAVFGNLLVITAILHFKQLHTPTNFLVASLACADFLVGVTVM 76

  Fly    96 PFAILASM-------GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRT 153
            ||:.:.|:       ......|.|..|     ..|..|:|.|..:|:|||.|:..|:.|......
  Rat    77 PFSTVRSVEGCWYFGDTYCKFHTCFDT-----SFCFASLFHLCCISIDRYVAVTDPLTYPTKFTI 136

  Fly   154 RTAIFIISMCW------------------------VAGTIVGFLPLFGWHADVNHNQECLFVEVM 194
            ..:...|::.|                        ||.|.||     |..|.:|.|         
  Rat   137 SVSGVCIALSWFFSVTYSFSIFYTGANEEGIEELVVALTCVG-----GCQAPLNQN--------- 187

  Fly   195 DYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQI---VTMNPASDLSRRSSAAVVQVTTPG 256
                .|.|.|.....|.::|:..|..|:.|..:|.|:|   .....||..|.:...|        
  Rat   188 ----WVLLCFLLFFLPTVVMVFLYGRIFLVAKQQARKIEGSANQPQASSESYKERVA-------- 240

  Fly   257 RGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCI----KAFCPDCYVHPKLTL 317
                            :|:.||.:.|.|.:..|::.|:| |.|:.:    ..|....||: ::.:
  Rat   241 ----------------RRERKAAKTLGIAMAAFLVSWLP-YIIDAVIDAYMNFITPAYVY-EILV 287

  Fly   318 FCIILSHLNSAVNPVLYAYHLKDFRAALK 346
            :|:   :.|||:||::||:....||.|:|
  Rat   288 WCV---YYNSAMNPLIYAFFYPWFRKAIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 51/198 (26%)
7tm_1 58..334 CDD:278431 78/313 (25%)
Taar9NP_783192.1 7tm_4 34..>151 CDD:304433 35/121 (29%)
7tm_1 39..301 CDD:278431 78/313 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.