DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and TAAR6

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_778237.1 Gene:TAAR6 / 319100 HGNCID:20978 Length:345 Species:Homo sapiens


Alignment Length:334 Identity:92/334 - (27%)
Similarity:148/334 - (44%) Gaps:60/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99
            ||.|.: |.|.||. ..|::::.||:||:|.....::|...||:.:.|||.||.|||...:||::
Human    28 SPGSRV-ILYIVFG-FGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSM 90

  Fly   100 LASMG----LPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFII 160
            :.::.    ..|:.  |.|.....|..|..|:|.|..:|:|||.|:..|:.|........:...|
Human    91 VRTVESCWYFGRSF--CTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICI 153

  Fly   161 SMCWVAGTIVGFLPLF--------GWHAD----VNHNQECL--FVEVMDYNYLVFLYFATIITPA 211
            |:.|:       |||.        |.:.|    ::....|:  ...|::.|: |...|.:...|.
Human   154 SVSWI-------LPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNW-VLTDFLSFFIPT 210

  Fly   212 LLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            .:|:..|.:|:.|..:|.::|......::.|..|..|.|                     .:|:.
Human   211 FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARV---------------------ARRER 254

  Fly   277 KATQNLSIIVLFFMICWIPLYTINCIKAF----CPDCYVHPKLTLFCIILSHLNSAVNPVLYAYH 337
            ||.:.|.:.|:.|||.|:|....:.|.||    .|.|...     .|...::.|||:||::||..
Human   255 KAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYE-----ICCWCAYYNSAMNPLIYALF 314

  Fly   338 LKDFRAALK 346
            ...||.|:|
Human   315 YPWFRKAIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/185 (27%)
7tm_1 58..334 CDD:278431 78/297 (26%)
TAAR6NP_778237.1 7tm_4 43..>271 CDD:304433 66/258 (26%)
7tm_1 49..311 CDD:278431 78/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.