DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and S1pr2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_058888.1 Gene:S1pr2 / 29415 RGDID:68334 Length:352 Species:Rattus norvegicus


Alignment Length:345 Identity:83/345 - (24%)
Similarity:146/345 - (42%) Gaps:73/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMA 86
            |...|.:.....::||.::   .:.|.:::....::.|:||:|...|..|.......::.:||.:
  Rat    17 HYNYTKETLDMQETPSRKV---ASAFIIILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAAS 78

  Fly    87 DLLVGALGIPFAILASMGLPRNLHACLFTVSL-----------LVVLCTISIFCLVAVSVDRYWA 140
            |||.|...:...:|:..          .|:||           ..:..:.|:|.|:|::::|..|
  Rat    79 DLLAGVAFVANTLLSGP----------VTLSLTPLQWFAREGSAFITLSASVFSLLAIAIERQVA 133

  Fly   141 ILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQEC---LFVEVMDYNYLVFL 202
            |.....|..:...| .:.:|...|:...|:|.||:.||:. ::|.:.|   |.:....|...|..
  Rat   134 IAKVKLYGSDKSCR-MLMLIGASWLISLILGGLPILGWNC-LDHLEACSTVLPLYAKHYVLCVVT 196

  Fly   203 YFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRV 267
            .|:.|:   |.::|.|..||.|:                  |||.|.|      .|..|..:|: 
  Rat   197 IFSVIL---LAIVALYVRIYFVV------------------RSSHADV------AGPQTLALLK- 233

  Fly   268 LGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCP--DCYVHPKLTLFCIILSHLNSAVN 330
                         .::|::..|:|||:|.::|..:.:.||  .|.|..|...| ...:.|||.:|
  Rat   234 -------------TVTIVLGVFIICWLPAFSILLLDSTCPVRACPVLYKAHYF-FAFATLNSLLN 284

  Fly   331 PVLYAYHLKDFRAALKNLLL 350
            ||:|.:..:|.|..:...||
  Rat   285 PVIYTWRSRDLRREVLRPLL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/181 (24%)
7tm_1 58..334 CDD:278431 73/291 (25%)
S1pr2NP_058888.1 7tm_1 50..288 CDD:278431 73/291 (25%)
7tm_4 51..299 CDD:304433 76/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.