DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Ptgir

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001071112.1 Gene:Ptgir / 292661 RGDID:1310890 Length:416 Species:Rattus norvegicus


Alignment Length:370 Identity:76/370 - (20%)
Similarity:125/370 - (33%) Gaps:104/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAKDSDSPSSEL---------------NIPYTVFEV------LVAIVSIIGNVLVI-IVFRRERK 71
            |...|.:|.|.|               ||.|....|      |:.:..::||.|.: |:..|.|.
  Rat     9 DGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNGLALGILGARRRS 73

  Fly    72 LRRRTNYYIVSLAMADLLVGALGIPFAILA------SMGLPRN----LHACLFTVSLLVVLCTIS 126
            ........:..||:.|||......|...:|      .:||...    .....|.::...:..|:.
  Rat    74 HPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAMTFFGLASTLI 138

  Fly   127 IFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQEC--- 188
            :|   |::|:|..|:.:|..|::....|.|...:...:....:...|||.|..   .|.|.|   
  Rat   139 LF---AMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFCSLPLLGLG---EHQQYCPGS 197

  Fly   189 -LFVEV-----------MDYNYLVFLYFATI------ITPALLMLAFYTHIYRVIIKQVRQIVTM 235
             .|:.:           :.|..|:.|...:|      :|.:|      .|:||    |.|:    
  Rat   198 WCFIRMRSPQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSL------CHMYR----QQRR---- 248

  Fly   236 NPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTIN 300
                                    |.|:.:.. ..||:.:|.....|:::.....:|.:||....
  Rat   249 ------------------------HHGSFVPT-SRAREDEVYHLILLALMTGIMAVCSLPLTIRG 288

  Fly   301 CIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAAL 345
            ..:|..||......|..|..      :|.||:|..:....||.|:
  Rat   289 FTQAIAPDSREMGDLHAFRF------NAFNPILDPWVFILFRKAV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 40/199 (20%)
7tm_1 58..334 CDD:278431 62/307 (20%)
PtgirNP_001071112.1 7tm_4 56..>247 CDD:304433 44/206 (21%)
7tm_1 59..319 CDD:278431 63/310 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.