DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Lgr4

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_775450.2 Gene:Lgr4 / 286994 RGDID:628615 Length:951 Species:Rattus norvegicus


Alignment Length:398 Identity:80/398 - (20%)
Similarity:131/398 - (32%) Gaps:141/398 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HAATTSKDAKDSDSPSSELN-----------------------------IPYTVFEVLVAIVSII 57
            |:.|..|.|.|:.:.:|...                             |..||:  .:.:|:::
  Rat   492 HSVTKEKGATDAANVTSTAENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVW--FIFLVALL 554

  Fly    58 GNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGA-LGI-------------PFAILASMGLPRN 108
            .|:|||:...........:..:|..:::::||:|. .||             .|.|....|    
  Rat   555 FNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIYTGILTFLDAVSWGRFAEFGIWWETG---- 615

  Fly   109 LHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFL 173
             ..|....||.|.....::|.|...:|:|.......|.:.::...|.......:..:...:.|..
  Rat   616 -SGCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDLMKHGKSSHLRQFQVAALLALLGAAVAGCF 679

  Fly   174 PLFGWH-ADVNHNQECL------------FVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVI 225
            |||  | ...:.:..||            .|.::..|.|.|          |||...||.:|..:
  Rat   680 PLF--HGGQYSASPLCLPFPTGETPSLGFTVTLVLLNSLAF----------LLMAIIYTKLYCNL 732

  Fly   226 IKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFM 290
            .|:           |||..|.::|::        |                              
  Rat   733 EKE-----------DLSENSQSSVIK--------H------------------------------ 748

  Fly   291 ICWIPLYTINCIKAFCPDCYVH--PKLTLFCI----------ILSHLNSAVNPVLYAYHLKDFRA 343
            :.|: ::| ||| .|||..:..  |.:|...|          |...|.:.:|||||.:....|:.
  Rat   749 VAWL-IFT-NCI-FFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKE 810

  Fly   344 ALKNLLLK 351
            ..|  |||
  Rat   811 DWK--LLK 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 39/194 (20%)
7tm_1 58..334 CDD:278431 63/314 (20%)
Lgr4NP_775450.2 LRRNT 29..61 CDD:214470
LRR 1 58..79
leucine-rich repeat 59..82 CDD:275380
LRR <62..301 CDD:227223
LRR 2 82..103
leucine-rich repeat 83..106 CDD:275380
LRR 3 106..127
leucine-rich repeat 107..130 CDD:275380
LRR 4 130..151
leucine-rich repeat 131..154 CDD:275380
LRR 5 154..177
leucine-rich repeat 155..178 CDD:275380
LRR 6 178..199
leucine-rich repeat 179..202 CDD:275380
LRR 7 202..223
leucine-rich repeat 203..226 CDD:275380
LRR 8 226..247
leucine-rich repeat 227..249 CDD:275380
LRR 9 249..270
leucine-rich repeat 250..273 CDD:275380
LRR 10 273..294
leucine-rich repeat 274..295 CDD:275380
LRR 275..>465 CDD:227223
LRR 11 320..341
leucine-rich repeat 321..344 CDD:275378
LRR 12 344..365
LRR_8 345..401 CDD:404697
leucine-rich repeat 345..366 CDD:275378
LRR 13 366..387
leucine-rich repeat 367..390 CDD:275378
LRR 14 390..411
leucine-rich repeat 391..414 CDD:275378
LRR 15 414..435
leucine-rich repeat 415..427 CDD:275378
leucine-rich repeat 436..461 CDD:275380
7tmA_LGR4 539..812 CDD:320483 70/343 (20%)
TM helix 1 541..565 CDD:320483 8/25 (32%)
TM helix 2 574..595 CDD:320483 6/20 (30%)
TM helix 3 619..641 CDD:320483 5/21 (24%)
TM helix 4 664..680 CDD:320483 1/15 (7%)
TM helix 5 704..727 CDD:320483 8/32 (25%)
TM helix 6 746..768 CDD:320483 9/62 (15%)
TM helix 7 780..805 CDD:320483 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.