DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and P2RY8

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens


Alignment Length:341 Identity:78/341 - (22%)
Similarity:149/341 - (43%) Gaps:77/341 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99
            :|:..:.:|  |...|||.|||.||:..:.|..|....|..:..::::|::.||::.:: :||.|
Human   208 NPAIAVALP--VVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDLMLASV-LPFQI 269

  Fly   100 LASMGLPRNLHACLFTVSLLVVLCTI-----------SIFCLVAVSVDRYWAILYPMAYSRNVRT 153
            ....    |.|..:|.    |:||.:           ||..:..:||:|:..:|||::..|..|.
Human   270 YYHC----NRHHWVFG----VLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRR 326

  Fly   154 RTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFV----EVMDYNYLVFLYFATIITPALLM 214
            |.|:...:..|:. .:....||.  ..|:.:....|.:    :|:.:..|          |::.|
Human   327 RYAVAACAGTWLL-LLTALSPLA--RTDLTYPVHALGIITCFDVLKWTML----------PSVAM 378

  Fly   215 LAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVL------GAARK 273
            .|.:.....:::..:..::|:                      ..:|.|:|::|      |..::
Human   379 WAVFLFTIFILLFLIPFVITV----------------------ACYTATILKLLRTEEAHGREQR 421

  Fly   274 RDVKATQNLSIIVLFFMICWIP----LYTINCIKAFCPDCYVHP-KLTLFCIILSHLNSAVNPVL 333
            |  :|....::::|.|:.|:.|    |......:.|....|.|. |||| |  ||.||:.::|.:
Human   422 R--RAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTL-C--LSCLNNCLDPFV 481

  Fly   334 YAYHLKDFRAALKNLL 349
            |.:..::|:..|:..|
Human   482 YYFASREFQLRLREYL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/182 (24%)
7tm_1 58..334 CDD:278431 65/301 (22%)
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 30/107 (28%)
7tm_1 229..482 CDD:278431 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.