DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and GPR19

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_011518925.1 Gene:GPR19 / 2842 HGNCID:4473 Length:434 Species:Homo sapiens


Alignment Length:322 Identity:77/322 - (23%)
Similarity:135/322 - (41%) Gaps:68/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNL 109
            ::|..::.:.||.||.||.:|..|.|:.:..|||::||:|.||||:.....||.:|.        
Human    88 SIFFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVLLQ-------- 144

  Fly   110 HACLFTV---SLLVVLCT-----------ISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFII 160
                ||.   :|....|.           :.|:.|:::.:||::.|:||:::  .|....|..:|
Human   145 ----FTTGRWTLGSATCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSF--KVSREKAKKMI 203

  Fly   161 SMCWV--AGTIVGFLPLFGWHADVNHNQECLFVEVMDYN---YLVFLYFATIITPALLMLAFYTH 220
            :..||  ||.:...|..:|    .|.:..|.:.....:.   |.|..:....:.|::|::.||..
Human   204 AASWVFDAGFVTPVLFFYG----SNWDSHCNYFLPSSWEGTAYTVIHFLVGFVIPSVLIILFYQK 264

  Fly   221 IYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSII 285
            :.:.|.:                        :.|.||     |:.|.:....:..||..:...|:
Human   265 VIKYIWR------------------------IGTDGR-----TVRRTMNIVPRTKVKTIKMFLIL 300

  Fly   286 VLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCII-LSHLNSAVNPVLYAYHLKDFRAALK 346
            .|.|::.|:|.:..........| |....|....|. :|..:||..|.||:.:..:||..:|
Human   301 NLLFLLSWLPFHVAQLWHPHEQD-YKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/186 (27%)
7tm_1 58..334 CDD:278431 69/295 (23%)
GPR19XP_011518925.1 7tm_4 91..>277 CDD:304433 52/227 (23%)
7tm_1 101..349 CDD:278431 69/295 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.