DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Taar7e

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001010835.1 Gene:Taar7e / 276742 MGIID:3527445 Length:358 Species:Mus musculus


Alignment Length:339 Identity:93/339 - (27%)
Similarity:150/339 - (44%) Gaps:70/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99
            ||...| |.|.||. ..|::::.||:||:......|:|....|:.:.|||.||.|||...:||:.
Mouse    43 SPGPRL-ILYAVFG-FGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFST 105

  Fly   100 LASM-------GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI 157
            :.|:       .:...||.| |.||    .|:.|||.|..:|||||.|:..|:.|........:.
Mouse   106 VRSVEGCWYFGEIYCKLHTC-FDVS----FCSSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSN 165

  Fly   158 FIISMCWVAGTIVGFLPLFGWHADVN-----------------HNQECLFVEVMDYNYLVFLYFA 205
            ..|:..|:.....||..::...::..                 .||..:|:     |:|:||   
Mouse   166 KCITFSWLLSISYGFSLIYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFI-----NFLLFL--- 222

  Fly   206 TIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGA 270
               .|.|:|:..|:.|:.:..:|.:.|..|  :...:|.|.:...:|.                 
Mouse   223 ---IPTLVMITVYSKIFLIAKQQAQNIEKM--SKQTARASDSYKDRVA----------------- 265

  Fly   271 ARKRDVKATQNLSIIVLFFMICWIPLYT---INCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPV 332
              ||:.||.:.|.|.|..|::.|:|.:.   |:....|....||:..|    :.:::.|||:||:
Mouse   266 --KRERKAAKTLGIAVAAFLLSWLPYFIDSFIDAFLGFITPTYVYEIL----VWIAYYNSAMNPL 324

  Fly   333 LYAYHLKDFRAALK 346
            :||:....||.|:|
Mouse   325 IYAFFYPWFRKAIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 53/191 (28%)
7tm_1 58..334 CDD:278431 79/302 (26%)
Taar7eNP_001010835.1 7tm_4 54..>184 CDD:304433 43/135 (32%)
7tm_1 64..326 CDD:278431 79/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.