DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Mc5r

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_037314.1 Gene:Mc5r / 25726 RGDID:3058 Length:325 Species:Rattus norvegicus


Alignment Length:372 Identity:76/372 - (20%)
Similarity:149/372 - (40%) Gaps:85/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAFRYFSITDFSFEGPLLPLHAATTS---KDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLV 62
            |::..:.::.|       |.|:|:..:   ::..:..|...::.|...|| :.:.:||::.|:||
  Rat     1 MNSSSHLTLLD-------LTLNASEDNILGQNVNNKSSACEDMGIAVEVF-LTLGLVSLLENILV 57

  Fly    63 IIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHACLFTV----------S 117
            |....:.:.|.....:::.|||:||:||........|  ::.|..|.|..:...          |
  Rat    58 IGAIVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETI--TIYLINNKHVVIADTFVRHIDNVFDS 120

  Fly   118 LLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADV 182
            ::.:....|:..|:|::||||..|.|.:.|...:..|.:..||:..|......|.          
  Rat   121 MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGI---------- 175

  Fly   183 NHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSA 247
                  :|:...:..|::....:...|....|::.|.|::.:....|::|......:.:.:|:|.
  Rat   176 ------VFIIYYESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASM 234

  Fly   248 AVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVH 312
                     :|..|.|||  ||                  .|::||.|.:....:...||.    
  Rat   235 ---------KGAITLTML--LG------------------IFIVCWSPFFLHLILMISCPQ---- 266

  Fly   313 PKLTLFC----------IILSHLNSAVNPVLYAYHLKDFRAALKNLL 349
               .::|          :||...||.::|::||...::.|...|.::
  Rat   267 ---NVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQEMRRTFKEII 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 39/177 (22%)
7tm_1 58..334 CDD:278431 61/295 (21%)
Mc5rNP_037314.1 7tm_4 43..311 CDD:304433 68/323 (21%)
7tm_1 53..295 CDD:278431 61/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.