DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Trhr

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_037179.1 Gene:Trhr / 25570 RGDID:3904 Length:412 Species:Rattus norvegicus


Alignment Length:351 Identity:90/351 - (25%)
Similarity:148/351 - (42%) Gaps:63/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SELN-----------IPYTVFEVLVAIV----SIIGNVLVIIVFRRERKLRRRTNYYIVSLAMAD 87
            ||||           :.|.|..:|:.:|    .|:||::|::|..|.:.:|..||.|:||||:||
  Rat     7 SELNQTELPPQVAVALEYQVVTILLVVVICGLGIVGNIMVVLVVMRTKHMRTATNCYLVSLAVAD 71

  Fly    88 LLVGALGIPFAILASMGLPR-----------NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAI 141
            |:|         |.:.|||.           ....||....|..:....|...:.|.:::||.||
  Rat    72 LMV---------LVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAI 127

  Fly   142 LYPM------AYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEV---MDYN 197
            .:|:      .:||      |..||...|...:|...|..|....:::..::.:.:..   :..|
  Rat   128 CHPIKAQFLCTFSR------AKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCGYKISRN 186

  Fly   198 YLVFLYFATI----ITPALLMLAFYTHIYRVIIKQVRQIVTMNP-ASDLSRRSSAAVVQVTTPGR 257
            |...:|....    :.|.:|....|..|.|::.        :|| .||....|.......|...:
  Rat   187 YYSPIYLMDFGVFYVMPMILATVLYGFIARILF--------LNPIPSDPKENSKTWKNDSTHQNK 243

  Fly   258 GGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIIL 322
            ..:..|..|...:......:.|:.|:::|:.|.:.|:|..|:..:.:|....:......|||.|.
  Rat   244 NMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRIC 308

  Fly   323 SHLNSAVNPVLYAYHLKDFRAALKNL 348
            .:||||:|||:|....:.||||.:.|
  Rat   309 IYLNSAINPVIYNLMSQKFRAAFRKL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 48/195 (25%)
7tm_1 58..334 CDD:278431 75/300 (25%)
TrhrNP_037179.1 7tm_4 38..>194 CDD:304433 44/170 (26%)
7tm_1 42..320 CDD:278431 75/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.