DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Fshr

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_954707.1 Gene:Fshr / 25449 RGDID:2632 Length:692 Species:Rattus norvegicus


Alignment Length:397 Identity:81/397 - (20%)
Similarity:145/397 - (36%) Gaps:119/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSKDAKDSDSPSSELNIPYTVFEVL---VAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMAD 87
            |.....|:.:|..:: :.|.:..||   ::|::|.||..|::|....:.......:.:.:||.||
  Rat   344 TCSPKPDAFNPCEDI-MGYNILRVLIWFISILAITGNTTVLVVLTTSQYKLTVPRFLMCNLAFAD 407

  Fly    88 LLVGALGIPFAILASMGLPRNLH--------------------ACLFTVSLLVVLCTISIFCLVA 132
            |   .:||...::||:    ::|                    |..||    |....:|::.|.|
  Rat   408 L---CIGIYLLLIASV----DIHTKSQYHNYAIDWQTGAGCDAAGFFT----VFASELSVYTLTA 461

  Fly   133 VSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYN 197
            ::::|:..|.:.|.....|:.|.|..::.:.|.........|:||    ::...:......||.:
  Rat   462 ITLERWHTITHAMQLECKVQLRHAASVMVLGWTFAFAAALFPIFG----ISSYMKVSICLPMDID 522

  Fly   198 Y-LVFLYFATIITPALLMLAF------YTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTP 255
            . |..||...::  .|.:|||      |||||         :...||          .:|..:: 
  Rat   523 SPLSQLYVMALL--VLNVLAFVVICGCYTHIY---------LTVRNP----------TIVSSSS- 565

  Fly   256 GRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICW-------------IPLYTINCIKAFCP 307
                               |.|..:.::.::....:|.             :||.|::       
  Rat   566 -------------------DTKIAKRMATLIFTDFLCMAPISFFAISASLKVPLITVS------- 604

  Fly   308 DCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQ------AEAIHR 366
                  |..:..::...:||..||.|||...|:||.....||.|....::..|      :.|.|.
  Rat   605 ------KAKILLVLFYPINSCANPFLYAIFTKNFRRDFFILLSKFGCYEMQAQIYRTETSSATHN 663

  Fly   367 FSVASQH 373
            |.....|
  Rat   664 FHARKSH 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/194 (22%)
7tm_1 58..334 CDD:278431 59/315 (19%)
FshrNP_954707.1 LRRNT 23..50 CDD:214470
LRR 1 49..72
LRR_8 72..132 CDD:290566
leucine-rich repeat 72..96 CDD:275380
LRR 2 73..97
leucine-rich repeat 97..121 CDD:275380
LRR 3 98..118
LRR 4 119..143
leucine-rich repeat 122..143 CDD:275380
leucine-rich repeat 144..171 CDD:275380
LRR 5 144..169
LRR 6 170..192
leucine-rich repeat 172..194 CDD:275380
LRR_8 193..245 CDD:290566
LRR 7 193..216
leucine-rich repeat 195..219 CDD:275380
LRR 8 217..240
leucine-rich repeat 220..243 CDD:275380
LRR 9 241..259
GnHR_trans 282..348 CDD:289164 1/3 (33%)
7tm_1 378..625 CDD:278431 59/315 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.