DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Drd5

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_036900.1 Gene:Drd5 / 25195 RGDID:2523 Length:475 Species:Rattus norvegicus


Alignment Length:438 Identity:111/438 - (25%)
Similarity:186/438 - (42%) Gaps:86/438 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LVAIVSIIGNVLVIIVFRRERKLR-RRTNYYIVSLAMADLLVGALGIPFAILASMG--LPRNLHA 111
            |:.:.:::|||||.....|.|.|| :.||.:|||||::||.|..|.:|:..:|.:.  .|.... 
  Rat    47 LLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGTF- 110

  Fly   112 CLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL- 175
            |...|:..::..|.||..|..:||||||||..|..|.|.:..|.|:.::.:.|....::.|:|: 
  Rat   111 CDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVGLAWTLSILISFIPVQ 175

  Fly   176 FGWHADV--NHNQECLFV-------------------EVMDYNYLVFLYFATIITPALLMLAFYT 219
            ..||.|.  :..||.|..                   ..::..|.:.....:...|..:|:..||
  Rat   176 LNWHRDKAGSQGQEGLLSNGTPWEEGWELEGRTENCDSSLNRTYAISSSLISFYIPVAIMIVTYT 240

  Fly   220 HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSI 284
            .|||:...|:|:|.::..|::.::...:.......|.           |.|:.|::.|..:.||:
  Rat   241 RIYRIAQVQIRRISSLERAAEHAQSCRSRGAYEPDPS-----------LRASIKKETKVFKTLSM 294

  Fly   285 IVLFFMICWIPLYTINCIKAFCPD-----------CYVHPKLTLFCIILSHLNSAVNPVLYAYHL 338
            |:..|:.||:|.:.:||:..||..           |.......:| :.....||::||::||:: 
  Rat   295 IMGVFVCCWLPFFILNCMVPFCSSGDAEGPKTGFPCVSETTFDIF-VWFGWANSSLNPIIYAFN- 357

  Fly   339 KDFRAALKNLL--------LKMMGVDID------QQAEAIHR-FSVASQHRL-QSMDSNMRST-- 385
            .|||.....||        ..:..|:|.      .|....|: .:.|..|.: .::.|..|..  
  Rat   358 ADFRKVFAQLLGCSHFCFRTPVQTVNISNELISYNQDTVFHKEIATAYVHMIPNAVSSGDREVGE 422

  Fly   386 ----QPRLYVGEYSP-----------IWLRQQQEAL---KNSQLLPKC 415
                .|..::.:.||           :|....:|.:   |.|.|.|.|
  Rat   423 EEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGKISPLTPNC 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 55/192 (29%)
7tm_1 58..334 CDD:278431 85/311 (27%)
Drd5NP_036900.1 7tm_1 55..354 CDD:278431 85/311 (27%)
7tm_4 <121..>173 CDD:304433 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..443 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.