DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Adra1b

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_058687.2 Gene:Adra1b / 24173 RGDID:2054 Length:515 Species:Rattus norvegicus


Alignment Length:513 Identity:129/513 - (25%)
Similarity:217/513 - (42%) Gaps:110/513 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ITDFSFEGPLLPLHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIV--SIIGNVLVIIVFRRERK 71
            :.|.:|.||         ::.:.:|..|..::....:|..||.|.:  :|:||:|||:.....|.
  Rat    20 LKDDNFTGP---------NQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRH 75

  Fly    72 LRRRTNYYIVSLAMADLLVGALGIPF-AILASMG---LPRNLHACLFTVSLLVVLCTISIFCLVA 132
            ||..|||:||:||:||||:....:|| |.|..:|   |.|..  |....::.|:.||.||..|.|
  Rat    76 LRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIF--CDIWAAVDVLCCTASILSLCA 138

  Fly   133 VSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADV-NHNQECLFVEVMDY 196
            :|:|||..:.|.:.|...|..|.||..:...||..|::...||.||.... |.::||...|  :.
  Rat   139 ISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTE--EP 201

  Fly   197 NYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQV--------- 252
            .|.:|....:...|..::|..|..:| ::.|:..:.:......::| .|....:::         
  Rat   202 FYALFSSLGSFYIPLAVILVMYCRVY-IVAKRTTKNLEAGVMKEMS-NSKELTLRIHSKNFHEDT 264

  Fly   253 --TTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLY-------TINCIKAFCPD 308
              :|..:|.:..:.:.|......|:.||.:.|.|:|..|::||:|.:       ..:.:|.  ||
  Rat   265 LSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKP--PD 327

  Fly   309 CYVHPKLTLFCII--LSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVAS 371
                   .:|.::  |.:.||.:||::|....|:|:.|    .::::|                 
  Rat   328 -------AVFKVVFWLGYFNSCLNPIIYPCSSKEFKRA----FMRILG----------------- 364

  Fly   372 QHRLQSMDSNMRSTQPRL----YVGEYSPIWLR----QQQEALKNSQLLPKCGVVSPCFNNINQT 428
               .|......|..:.||    |.  |.| |.|    ::.::.|:|  |...|   .|.:...:|
  Rat   365 ---CQCRGGRRRRRRRRLGGCAYT--YRP-WTRGGSLERSQSRKDS--LDDSG---SCMSGSQRT 418

  Fly   429 VAAVASVTTDLEREMWNIVEASSGAELGETSYEFPSPAPGSQRSSERNSSSTVPPAPP 486
            :.:.:.....|.|.....||..:          ||...||:..|.         |.||
  Rat   419 LPSASPSPGYLGRGTQPPVELCA----------FPEWKPGALLSL---------PEPP 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 62/174 (36%)
7tm_1 58..334 CDD:278431 86/300 (29%)
Adra1bNP_058687.2 7tmA_alpha1B_AR 46..359 CDD:320449 95/331 (29%)
TM helix 1 48..72 CDD:320449 10/23 (43%)
TM helix 2 81..103 CDD:320449 12/21 (57%)
TM helix 3 119..141 CDD:320449 7/21 (33%)
TM helix 4 164..180 CDD:320449 3/15 (20%)
TM helix 5 201..224 CDD:320449 4/22 (18%)
TM helix 6 293..315 CDD:320449 7/21 (33%)
TM helix 7 327..352 CDD:320449 8/31 (26%)
Nuclear localization signal. /evidence=ECO:0000250 368..378 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..430 6/42 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.