DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Npffr1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001170982.1 Gene:Npffr1 / 237362 MGIID:2685082 Length:432 Species:Mus musculus


Alignment Length:339 Identity:77/339 - (22%)
Similarity:150/339 - (44%) Gaps:71/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILA 101
            ||.:...:.....|:.::.::||.||..:..:.|.:|..||.:|::||::|||||...:|..::.
Mouse    39 SSPVAAMFIAAYALIFLLCMVGNTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGIFCMPTTLVD 103

  Fly   102 SM--GLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCW 164
            ::  |.|.:...|..:..:..:..:.|:|.|||::|:|:..|::|  :...:..|.|:..|::.|
Mouse   104 NLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFRCIVHP--FREKLTLRKALLTIAVIW 166

  Fly   165 VAGTIV---------------GFL--------PLFG-WHADVNHNQECLFVEVMDYNYLVFLYFA 205
            ....::               .|:        ||:. |.|........::..|:         ||
Mouse   167 ALALLIMCPSAVTLTVTREEHHFMLDARNRSYPLYSCWEAWPEKGMRKVYTAVL---------FA 222

  Fly   206 TI-ITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLG 269
            .| :.|..|::..|..|.|.:.:      ...||.|    :..||.:      ||.         
Mouse   223 HIYLAPLALIVVMYARIARKLCQ------APGPARD----AEEAVAE------GGR--------- 262

  Fly   270 AARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAF--CPDCYVHPKLTLFCIILSH----LNSA 328
             |.:|..:....|.::.|||.:.|:||:.:..:..:  ..:..:| .|:::...|:|    .:|:
Mouse   263 -ASRRRARVVHMLVMVALFFTLSWLPLWVLLLLIDYGELSELQLH-LLSVYAFPLAHWLAFFHSS 325

  Fly   329 VNPVLYAYHLKDFR 342
            .||::|.|..::||
Mouse   326 ANPIIYGYFNENFR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 45/194 (23%)
7tm_1 58..334 CDD:278431 70/308 (23%)
Npffr1NP_001170982.1 7tm_4 54..>173 CDD:304433 33/120 (28%)
7tm_1 60..331 CDD:278431 70/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.