DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Gpbar1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_778150.1 Gene:Gpbar1 / 227289 MGIID:2653863 Length:329 Species:Mus musculus


Alignment Length:341 Identity:90/341 - (26%)
Similarity:141/341 - (41%) Gaps:66/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSELN-IPYTVFEVLVAIVS--IIGNVLVIIVFRRERKLRR-RTNYYIVSLAMADLLVGALGIPF 97
            |:||: ||..|..:.:|:.|  :|.|:|:.:....:|.||. ....:.:||.:|.||.| |.:|.
Mouse     6 STELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTG-LALPM 69

  Fly    98 AILASMGLPRNLH----ACLFTVSLLVVLCTISIFC-LVAVSVDRYWAILYPMAYSRNVRTRTAI 157
            .    .||....|    :||. :.|....|.:|:.. |:.|..:||.|:|.|:....:|  |.|:
Mouse    70 L----PGLWSRNHQGYWSCLL-LHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSV--RLAL 127

  Fly   158 FIISMCWVAGTIVGFLPLFGWH---ADVNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYT 219
            |   :.||:......||..||:   .|.|.:.:.:|.....|..:..|....:...|||.:    
Mouse   128 F---LTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSV---- 185

  Fly   220 HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSI 284
               ||:....||:..:       ||...||.: ..|      .|:.|.|   ..|..:|....: 
Mouse   186 ---RVLATAHRQLCEI-------RRLERAVCR-DVP------STLARAL---TWRQARAQAGAT- 229

  Fly   285 IVLFFMICWIP-----LYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKD---- 340
              |.|::||.|     |.::...:...|   :.|...|..|.|...::|..||  |..|.|    
Mouse   230 --LLFLLCWGPYVATLLLSVLAYERRPP---LGPGTLLSLISLGSTSAAAVPV--AMGLGDQRYT 287

  Fly   341 --FRAALKNLLLKMMG 354
              :|.|.:..|..:.|
Mouse   288 APWRTAAQRCLRVLRG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 49/178 (28%)
7tm_1 58..334 CDD:278431 74/289 (26%)
Gpbar1NP_778150.1 7tm_1 <108..249 CDD:278431 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.