DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and dmsr-3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_496818.1 Gene:dmsr-3 / 190021 WormBaseID:WBGene00012993 Length:376 Species:Caenorhabditis elegans


Alignment Length:375 Identity:73/375 - (19%)
Similarity:143/375 - (38%) Gaps:132/375 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TVFE---------------VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALG 94
            ||||               :|:.|...:|::|.|...   ..:...||.:::|::.:.|   ||.
 Worm    11 TVFETFLLEYGRIIHPPMVLLLCISGALGHMLTITTL---SSMLNPTNMFLISMSCSQL---ALC 69

  Fly    95 IPF---------------AILASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYP 144
            |.|               ....|..|...:|   |:|::.|::...::|.:||:|:.|::::...
 Worm    70 INFLYSTFFKFMSDQLCQPFFFSYYLATTMH---FSVTVSVLVHMSAVFHVVALSLIRFFSLAQL 131

  Fly   145 MAYSRNV------RTRTAIF-----IISMCWVAGTIVGFLPLFGWH-----ADVNHNQECL---- 189
            .:.:.||      ::|.||.     :|.:|         :||   |     .:|:.|:.|.    
 Worm   132 SSVNSNVQWFTWQKSRVAIIMIYVSVIFLC---------IPL---HFTSQVTEVSENEGCAERYP 184

  Fly   190 --------------FVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASD 240
                          .:.:.:.|:.:| |....:.|::::.....    :|:.|:::|..      
 Worm   185 ALRNKVAYQLSYTQSIWLRNLNFWLF-YLVAKVVPSIILCIMTC----LILDQLKKIQV------ 238

  Fly   241 LSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIP------LYTI 299
            ||.|.|:.                     ...|:..:.|..:..|::.|:|..:|      |.|:
 Worm   239 LSARFSSV---------------------ERDKQHSRTTNMILAIMILFIIVELPQGVLAVLSTV 282

  Fly   300 NCIKAFCPDCYVHPKLT-LFCIILSHLNSAVNPVLYAYHLKDFRAALKNL 348
            ..:|..    |....|| ||.::.|.:   :..:|.:.:.| .|:|.|.|
 Worm   283 TSVKLI----YELGDLTELFTLLTSII---IFTLLCSMNGK-IRSAFKEL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 40/216 (19%)
7tm_1 58..334 CDD:278431 61/331 (18%)
dmsr-3NP_496818.1 7tm_GPCRs 23..321 CDD:391938 66/358 (18%)
TM helix 1 24..48 CDD:341315 5/26 (19%)
TM helix 2 54..78 CDD:341315 8/26 (31%)
TM helix 3 99..129 CDD:341315 9/32 (28%)
TM helix 4 144..164 CDD:341315 5/28 (18%)
TM helix 5 203..228 CDD:341315 4/29 (14%)
TM helix 6 250..280 CDD:341315 6/29 (21%)
TM helix 7 291..314 CDD:341315 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.