DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and srw-115

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_503815.2 Gene:srw-115 / 187325 WormBaseID:WBGene00005862 Length:367 Species:Caenorhabditis elegans


Alignment Length:448 Identity:81/448 - (18%)
Similarity:139/448 - (31%) Gaps:189/448 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPLHAATTSKDAKDSDSPSSELNIPYT--VFEVL--VAIVSIIGNVLVIIVFRRERKLRRRTNY 78
            ||.|:.|...|....|.....:..||::  |...|  |:|.||:.|::...:..|:.......|.
 Worm     8 LLSLYYAGFEKSTAKSLCEFEKKFIPFSSNVLSYLPDVSIASILINLIHFFILTRKPMRTSSINI 72

  Fly    79 YIVSLAMADLLVGALGIPFAILASMGLPRNLHACLF-------------TVSLLVVLCTISIFCL 130
            .:.::|:.|:|        |.|..:.|..:.::.:|             |..||.|:...|..|.
 Worm    73 LMAAIALFDIL--------ASLQQIELLLDRYSYIFFDCYPTYTYGLELTKVLLDVVRDYSRRCS 129

  Fly   131 VAVSVDRYWAILYPMAYSRNVRTR---------------TAIFIISMCWVA--GTIVGFLPLFGW 178
            .       |.|:: :|:.|.:..|               :||.|..:|..:  .:::.||     
 Worm   130 T-------WLIVF-IAFIRTLIVRNPMSTKFEALCQPKASAIIIAGICATSFPVSVLKFL----- 181

  Fly   179 HADVNHNQECLFVEV---------------------------MDYNYLVFLYFATIITPALLMLA 216
                    |..|:|:                           ..|.|| |..|.:.|.|.:|:  
 Worm   182 --------EYQFIEIEGLESCAKGPHHIFAVSDLFTANDGFLAKYFYL-FNSFVSDIVPCILL-- 235

  Fly   217 FYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRD--VKAT 279
                          .|||:....||.|                          ||:||.  :..:
 Worm   236 --------------PIVTLLLVMDLWR--------------------------AAKKRTNLISVS 260

  Fly   280 QN--------LSIIVLFFMI----------CWI-------------------PLYTINCIKAFCP 307
            :|        ..:.::||::          .|:                   .|.|:|.    |.
 Worm   261 KNHNSRTGLVFCVTIMFFIVEFPYGLSMGFVWMYNDVLGLQHMMSRFAFMFAMLITLNT----CT 321

  Fly   308 DCYVHPKLTLFCIIL-SHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAI 364
            ..:|       |:|: ||..|....|....::..     ||.:.....|....|::.:
 Worm   322 HLFV-------CLIISSHYRSTAIYVFSCGYINS-----KNTIASRTQVTSSSQSKTL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 41/224 (18%)
7tm_1 58..334 CDD:278431 63/372 (17%)
srw-115NP_503815.2 TM helix 1 41..62 CDD:320109 6/20 (30%)
7TM_GPCR_Srw 45..344 CDD:370978 67/381 (18%)
TM helix 2 71..93 CDD:320109 7/29 (24%)
TM helix 3 116..138 CDD:320109 7/29 (24%)
TM helix 4 163..179 CDD:320109 3/15 (20%)
TM helix 5 217..240 CDD:320109 10/39 (26%)
TM helix 6 267..289 CDD:320109 2/21 (10%)
TM helix 7 305..330 CDD:320109 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.